Property Summary

NCBI Gene PubMed Count 37
Grant Count 36
R01 Count 10
Funding $7,181,792.94
PubMed Score 7.62
PubTator Score 117.26

Knowledge Summary

Patent

No data available

Expression

Gene RIF (17)

PMID Text
25652936 a high expression of CAP1 is involved in the pathogenesis of EOC, and that the downregulation of CAP1 in tumor cells may be a therapeutic target for the treatment of patients with EOC.
25371324 CAP1 is involved in the brain metastasis in non-small cell lung cancer.CAP1 overexpression is associated with poor prognosis in non-small cell lung cancer patients.
25332229 This study demonstrated an inverse relationship between CAP1 and MMP-9 expression, high expression of MMP-9 and low expression of CAP1 in those with chronic obstructive pulmonary disease compared with the non-chronic obstructive pulmonary disease group.
24606903 Overexpression of CAP1 in monocytes enhanced the resistin-induced increased activity of the cAMP-dependent signaling.
24522810 Overexpression of CAP1 is associated with breast carcinoma.
24509166 CAP1 might be a potential molecular targeted therapy for surgery and immune treatment.
24359721 results indicate that upregulated expression of CAP1 might contribute heavily to the metastasis of hepatocellular carcinoma.
23904342 Findings suggest that CAP1 (cyclase-associated protein 1) is involved in the metastasis of esophageal squamous cell carcinoma, and increased expression may indicate a poor prognosis.
23842884 overexpression of CAP1 in lung cancer cells, particularly at the metastatic stage, may have significant clinical implications as a diagnostic/prognostic factor for lung cancer.
23737525 CAP1 depletion also led to changes in cofilin phosphorylation and localization as well as activation of focal adhesion kinase (FAK) and enhanced cell spreading.
More...

AA Sequence

MADMQNLVERLERAVGRLEAVSHTSDMHRGYADSPSKAGAAPYVQAFDSLLAGPVAEYLKISKEIGGDVQ      1 - 70
KHAEMVHTGLKLERALLVTASQCQQPAENKLSDLLAPISEQIKEVITFREKNRGSKLFNHLSAVSESIQA     71 - 140
LGWVAMAPKPGPYVKEMNDAAMFYTNRVLKEYKDVDKKHVDWVKAYLSIWTELQAYIKEFHTTGLAWSKT    141 - 210
GPVAKELSGLPSGPSAGSCPPPPPPCPPPPPVSTISCSYESASRSSLFAQINQGESITHALKHVSDDMKT    211 - 280
HKNPALKAQSGPVRSGPKPFSAPKPQTSPSPKRATKKEPAVLELEGKKWRVENQENVSNLVIEDTELKQV    281 - 350
AYIYKCVNTTLQIKGKINSITVDNCKKLGLVFDDVVGIVEIINSKDVKVQVMGKVPTISINKTDGCHAYL    351 - 420
SKNSLDCEIVSAKSSEMNVLIPTEGGDFNEFPVPEQFKTLWNGQKLVTTVTEIAG                   421 - 475
//

Text Mined References (54)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25652936 2015 CAP1 is overexpressed in human epithelial ovarian cancer and promotes cell proliferation.
25371324 2015 Overexpression of adenylate cyclase-associated protein 1 may predict brain metastasis in non-small cell lung cancer.
25332229 2014 Relationship between expression of matrix metalloproteinase-9 and adenylyl cyclase-associated protein 1 in chronic obstructive pulmonary disease.
25114211 2014 Mapping of SUMO sites and analysis of SUMOylation changes induced by external stimuli.
24606903 2014 Adenylyl cyclase-associated protein 1 is a receptor for human resistin and mediates inflammatory actions of human monocytes.
24522810 2014 High expression and prognostic role of CAP1 and CtBP2 in breast carcinoma: associated with E-cadherin and cell proliferation.
24509166 2014 Knocking down the expression of adenylate cyclase-associated protein 1 inhibits the proliferation and migration of breast cancer cells.
24359721 2014 Upregulated expression of CAP1 is associated with tumor migration and metastasis in hepatocellular carcinoma.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
More...