Property Summary

NCBI Gene PubMed Count 66
PubMed Score 107.14
PubTator Score 73.29

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (7)

Disease Target Count P-value
non-small cell lung cancer 2798 1.15418118577093E-18
breast carcinoma 1614 2.73789998900871E-16
oligodendroglioma 2849 1.42194526206144E-11
posterior fossa group A ependymoma 1511 1.5106842947153E-7
malignant mesothelioma 3163 5.68802474246524E-7
pilocytic astrocytoma 3086 7.77177772743056E-7
colon cancer 1475 1.42766566364565E-6
lung carcinoma 2844 1.57535577233743E-6
pediatric high grade glioma 2712 4.47537053187678E-6
pituitary cancer 1972 5.46515768225665E-6
ovarian cancer 8492 7.50354283439531E-6
lung cancer 4473 1.95380122635768E-5
glioblastoma 5572 2.79274667147893E-5
atypical teratoid / rhabdoid tumor 4369 5.03010363178044E-5
medulloblastoma 1524 7.37050371826044E-5
medulloblastoma, large-cell 6234 1.63409336734223E-4
intraductal papillary-mucinous adenoma (IPMA) 2956 3.56573678122072E-4
intraductal papillary-mucinous carcinoma (IPMC) 2988 4.71832082620347E-4
psoriasis 6685 7.98238821661623E-4
dermatomyositis 967 9.61707685052725E-4
Pick disease 1893 0.00101594846221855
invasive ductal carcinoma 2950 0.00135124283649077
hereditary spastic paraplegia 313 0.00171638447254454
nephrosclerosis 329 0.00189133197884204
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00405212493534244
Atopic dermatitis 944 0.00612809922693777
ductal carcinoma in situ 1745 0.00731291526518405
primitive neuroectodermal tumor 3031 0.0154677205788768
Down syndrome 548 0.0267691977571984
acute myeloid leukemia 785 0.0281069306145244
adrenocortical carcinoma 1427 0.0347231277384584
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Kidney cancer 121 0.0 1.0
Disease Target Count Z-score Confidence
Prostate cancer 172 0.0 1.0
Disease Target Count Z-score Confidence
Long QT syndrome 53 5.547 2.8

Expression

  Differential Expression (31)

Synonym

Accession Q01484 Q01485 Q08AC7 Q08AC8 Q7Z3L5 ANK-2
Symbols LQT4
ANK-2
brank-2

Gene

PANTHER Protein Class (1)

PDB

4D8O   4RLV   4RLY  

  Ortholog (3)

Species Source
Macaque EggNOG Inparanoid
Mouse EggNOG Inparanoid
Rat EggNOG Inparanoid

Gene RIF (35)

PMID Text
26109584 The identification and characterization of two functionally distinct ankyrin-B isoforms in heart provide compelling evidence that alternative splicing of the ANK2 gene regulates the fidelity of ankyrin-B interactions with proteins
25383926 the structures of ANK repeats in complex with an inhibitory segment from the C-terminal regulatory domain and with a sodium channel Nav1.2 peptide, are reported.
23569209 ankyrin-B linker suppresses activity of the ANK repeat domain through an intramolecular interaction, likely with a groove on the surface of the ANK repeat solenoid, thereby regulating the affinities between ankyrin-B and its binding partners
23142288 Gankyrin plays an essential role in estrogen-driven and GPR30-mediated endometrial carcinoma cell proliferation via the PTEN/PI3K/AKT signaling pathway.
22861190 Residues 63-73 of cdB3 is also essential for ankyrin binding.
22778271 Ankyrin-B protein in heart failure: identification of a new component of metazoan cardioprotection.
21859974 Reduced ankyrin-B expression or mutations in ankyrin 2 are associated with atrial fibrillation.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20573981 Data show that DAnk2-binding is critical for beta spectrin function in vivo.
20471030 This protein has been found differentially expressed in thalami from patients with schizophrenia.
More...

AA Sequence

MMNEDAAQKSDSGEKFNGSSQRRKRPKKSDSNASFLRAARAGNLDKVVEYLKGGIDINTCNQNGLNALHL      1 - 70
AAKEGHVGLVQELLGRGSSVDSATKKGNTALHIASLAGQAEVVKVLVKEGANINAQSQNGFTPLYMAAQE     71 - 140
NHIDVVKYLLENGANQSTATEDGFTPLAVALQQGHNQAVAILLENDTKGKVRLPALHIAARKDDTKSAAL    141 - 210
LLQNDHNADVQSKMMVNRTTESGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTN    211 - 280
MVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERGAPLLARTKNGLSPLHMAAQGDHVECVKH    281 - 350
LLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIKVMELLVKY    351 - 420
GASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALV    421 - 490
DARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLAT    491 - 560
KKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGY    561 - 630
TPLHIAAKKNQMQIASTLLNYGAETNIVTKQGVTPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLH    631 - 700
LAAQEDKVNVADILTKHGADQDAHTKLGYTPLIVACHYGNVKMVNFLLKQGANVNAKTKNGYTPLHQAAQ    701 - 770
QGHTHIINVLLQHGAKPNATTANGNTALAIAKRLGYISVVDTLKVVTEEVTTTTTTITEKHKLNVPETMT    771 - 840
EVLDVSDEEGDDTMTGDGGEYLRPEDLKELGDDSLPSSQFLDGMNYLRYSLEGGRSDSLRSFSSDRSHTL    841 - 910
SHASYLRDSAVMDDSVVIPSHQVSTLAKEAERNSYRLSWGTENLDNVALSSSPIHSGFLVSFMVDARGGA    911 - 980
MRGCRHNGLRIIIPPRKCTAPTRVTCRLVKRHRLATMPPMVEGEGLASRLIEVGPSGAQFLGKLHLPTAP    981 - 1050
PPLNEGESLVSRILQLGPPGTKFLGPVIVEIPHFAALRGKERELVVLRSENGDSWKEHFCDYTEDELNEI   1051 - 1120
LNGMDEVLDSPEDLEKKRICRIITRDFPQYFAVVSRIKQDSNLIGPEGGVLSSTVVPQVQAVFPEGALTK   1121 - 1190
RIRVGLQAQPMHSELVKKILGNKATFSPIVTLEPRRRKFHKPITMTIPVPKASSDVMLNGFGGDAPTLRL   1191 - 1260
LCSITGGTTPAQWEDITGTTPLTFVNECVSFTTNVSARFWLIDCRQIQESVTFASQVYREIICVPYMAKF   1261 - 1330
VVFAKSHDPIEARLRCFCMTDDKVDKTLEQQENFAEVARSRDVEVLEGKPIYVDCFGNLVPLTKSGQHHI   1331 - 1400
FSFFAFKENRLPLFVKVRDTTQEPCGRLSFMKEPKSTRGLVHQAICNLNITLPIYTKESESDQEQEEEID   1401 - 1470
MTSEKNDETESTETSVLKSHLVNEVPVLASPDLLSEVSEMKQDLIKMTAILTTDVSDKAGSIKVKELVKA   1471 - 1540
AEEEPGEPFEIVERVKEDLEKVNEILRSGTCTRDESSVQSSRSERGLVEEEWVIVSDEEIEEARQKAPLE   1541 - 1610
ITEYPCVEVRIDKEIKGKVEKDSTGLVNYLTDDLNTCVPLPKEQLQTVQDKAGKKCEALAVGRSSEKEGK   1611 - 1680
DIPPDETQSTQKQHKPSLGIKKPVRRKLKEKQKQKEEGLQASAEKAELKKGSSEESLGEDPGLAPEPLPT   1681 - 1750
VKATSPLIEETPIGSIKDKVKALQKRVEDEQKGRSKLPIRVKGKEDVPKKTTHRPHPAASPSLKSERHAP   1751 - 1820
GSPSPKTERHSTLSSSAKTERHPPVSPSSKTEKHSPVSPSAKTERHSPASSSSKTEKHSPVSPSTKTERH   1821 - 1890
SPVSSTKTERHPPVSPSGKTDKRPPVSPSGRTEKHPPVSPGRTEKRLPVSPSGRTDKHQPVSTAGKTEKH   1891 - 1960
LPVSPSGKTEKQPPVSPTSKTERIEETMSVRELMKAFQSGQDPSKHKTGLFEHKSAKQKQPQEKGKVRVE   1961 - 2030
KEKGPILTQREAQKTENQTIKRGQRLPVTGTAESKRGVRVSSIGVKKEDAAGGKEKVLSHKIPEPVQSVP   2031 - 2100
EEESHRESEVPKEKMADEQGDMDLQISPDRKTSTDFSEVIKQELEDNDKYQQFRLSEETEKAQLHLDQVL   2101 - 2170
TSPFNTTFPLDYMKDEFLPALSLQSGALDGSSESLKNEGVAGSPCGSLMEGTPQISSEESYKHEGLAETP   2171 - 2240
ETSPESLSFSPKKSEEQTGETKESTKTETTTEIRSEKEHPTTKDITGGSEERGATVTEDSETSTESFQKE   2241 - 2310
ATLGSPKDTSPKRQDDCTGSCSVALAKETPTGLTEEAACDEGQRTFGSSAHKTQTDSEVQESTATSDETK   2311 - 2380
ALPLPEASVKTDTGTESKPQGVIRSPQGLELALPSRDSEVLSAVADDSLAVSHKDSLEASPVLEDNSSHK   2381 - 2450
TPDSLEPSPLKESPCRDSLESSPVEPKMKAGIFPSHFPLPAAVAKTELLTEVASVRSRLLRDPDGSAEDD   2451 - 2520
SLEQTSLMESSGKSPLSPDTPSSEEVSYEVTPKTTDVSTPKPAVIHECAEEDDSENGEKKRFTPEEEMFK   2521 - 2590
MVTKIKMFDELEQEAKQKRDYKKEPKQEESSSSSDPDADCSVDVDEPKHTGSGEDESGVPVLVTSESRKV   2591 - 2660
SSSSESEPELAQLKKGADSGLLPEPVIRVQPPSPLPSSMDSNSSPEEVQFQPVVSKQYTFKMNEDTQEEP   2661 - 2730
GKSEEEKDSESHLAEDRHAVSTEAEDRSYDKLNRDTDQPKICDGHGCEAMSPSSSAAPVSSGLQSPTGDD   2731 - 2800
VDEQPVIYKESLALQGTHEKDTEGEELDVSRAESPQADCPSESFSSSSSLPHCLVSEGKELDEDISATSS   2801 - 2870
IQKTEVTKTDETFENLPKDCPSQDSSITTQTDRFSMDVPVSDLAENDEIYDPQITSPYENVPSQSFFSSE   2871 - 2940
ESKTQTDANHTTSFHSSEVYSVTITSPVEDVVVASSSSGTVLSKESNFEGQDIKMESQQESTLWEMQSDS   2941 - 3010
VSSSFEPTMSATTTVVGEQISKVIITKTDVDSDSWSEIREDDEAFEARVKEEEQKIFGLMVDRQSQGTTP   3011 - 3080
DTTPARTPTEEGTPTSEQNPFLFQEGKLFEMTRSGAIDMTKRSYADESFHFFQIGQESREETLSEDVKEG   3081 - 3150
ATGADPLPLETSAESLALSESKETVDDEADLLPDDVSEEVEEIPASDAQLNSQMGISASTETPTKEAVSV   3151 - 3220
GTKDLPTVQTGDIPPLSGVKQISCPDSSEPAVQVQLDFSTLTRSVYSDRGDDSPDSSPEEQKSVIEIPTA   3221 - 3290
PMENVPFTESKSKIPVRTMPTSTPAPPSAEYESSVSEDFLSSVDEENKADEAKPKSKLPVKVPLQRVEQQ   3291 - 3360
LSDLDTSVQKTVAPQGQDMASIAPDNRSKSESDASSLDSKTKCPVKTRSYTETETESRERAEELELESEE   3361 - 3430
GATRPKILTSRLPVKSRSTTSSCRGGTSPTKESKEHFFDLYRNSIEFFEEISDEASKLVDRLTQSEREQE   3431 - 3500
IVSDDESSSALEVSVIENLPPVETEHSVPEDIFDTRPIWDESIETLIERIPDENGHDHAEDPQDEQERIE   3501 - 3570
ERLAYIADHLGFSWTELARELDFTEEQIHQIRIENPNSLQDQSHALLKYWLERDGKHATDTNLVECLTKI   3571 - 3640
NRMDIVHLMETNTEPLQERISHSYAEIEQTITLDHSEGFSVLQEELCTAQHKQKEEQAVSKESETCDHPP   3641 - 3710
IVSEEDISVGYSTFQDGVPKTEGDSSATALFPQTHKEQVQQDFSGKMQDLPEESSLEYQQEYFVTTPGTE   3711 - 3780
TSETQKAMIVPSSPSKTPEEVSTPAEEEKLYLQTPTSSERGGSPIIQEPEEPSEHREESSPRKTSLVIVE   3781 - 3850
SADNQPETCERLDEDAAFEKGDDMPEIPPETVTEEEYIDEHGHTVVKKVTRKIIRRYVSSEGTEKEEIMV   3851 - 3920
QGMPQEPVNIEEGDGYSKVIKRVVLKSDTEQSEDNNE                                    3921 - 3957
//

Text Mined References (74)

PMID Year Title
26638075 2015 A Dynamic Protein Interaction Landscape of the Human Centrosome-Cilium Interface.
26109584 2015 Identification and characterization of two ankyrin-B isoforms in mammalian heart.
25383926 2014 Structural basis of diverse membrane target recognitions by ankyrins.
24315451 2014 Fraction of exhaled nitric oxide values in childhood are associated with 17q11.2-q12 and 17q12-q21 variants.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23720494 2013 Genome-wide association study identifies loci affecting blood copper, selenium and zinc.
23569209 2013 A single divergent exon inhibits ankyrin-B association with the plasma membrane.
23142288 2013 Gankyrin plays an essential role in estrogen-driven and GPR30-mediated endometrial carcinoma cell proliferation via the PTEN/PI3K/AKT signaling pathway.
22861190 2012 Identification of contact sites between ankyrin and band 3 in the human erythrocyte membrane.
22778271 2012 Ankyrin-B protein in heart failure: identification of a new component of metazoan cardioprotection.
More...