Property Summary

NCBI Gene PubMed Count 61
PubMed Score 125.48
PubTator Score 87.97

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis 3.700 0.000

Synonym

Accession Q01469 B2R4K0
Symbols EFABP
KFABP
E-FABP
PAFABP
PA-FABP

Gene

PDB

1B56   1JJJ   4AZM   4AZR   4LKP   4LKT  

Gene RIF (38)

PMID Text
26625874 the balance between FABP4 and FABP5 in endothelial cells may be important in regulation of angiogenic versus quiescent phenotypes in blood vessels.
26614767 silencing of Sp1, c-Myc or FABP5 expression led to a significant decrease in cell proliferation, indicating that up-regulation of FABP5 expression by Sp1 and c-Myc is critical for the proliferation of prostate cancer cells
26592976 Long chain fatty acids suppress the oncogenic properties of FABP5-expressing carcinoma cells in cultured cells.
26020772 FABP5 may contribute to the airway remodeling and inflammation in asthma by fine-tuning the levels of CysLTs, which induce VEGF production.
25797252 CRABP-II and FABP5 expression patterns are neither related to the tumor grades nor correlated with RA sensitivity.
25027319 The frameshift and missense mutations in FABP3, FABP5, and FABP7 genes have been identified in schizophrenia and autism spectrum disorder in humans and in mouse behavioral studies.
24692551 Data indicate that fatty acid-binding protein 5 (FABP5) is tuned to selectively stimulate peroxisome proliferation-activated receptor beta/delta transactivation in response to specific fatty acids based on their structural features.
24244493 peripheral uptake of FA via capillary endothelial FABP4/5 is crucial for systemic metabolism and may establish FABP4/5 as potentially novel targets for the modulation of energy homeostasis.
24189640 Both C-FABP and PPARg are suitable as prognostic factors to predict the clinical outcome of prostatic cancer patients.
23722546 Our findings establish that FABP5 is critical for mammary tumor development
More...

AA Sequence

MATVQQLEGRWRLVDSKGFDEYMKELGVGIALRKMGAMAKPDCIITCDGKNLTIKTESTLKTTQFSCTLG      1 - 70
EKFEETTADGRKTQTVCNFTDGALVQHQEWDGKESTITRKLKDGKLVVECVMNNVTCTRIYEKVE          71 - 135
//

Text Mined References (69)

PMID Year Title
26625874 2016 Dual role of fatty acid-binding protein 5 on endothelial cell fate: a potential link between lipid metabolism and angiogenic responses.
26614767 2016 The cancer-promoting gene fatty acid-binding protein 5 (FABP5) is epigenetically regulated during human prostate carcinogenesis.
26592976 2015 Saturated fatty acids regulate retinoic acid signalling and suppress tumorigenesis by targeting fatty acid-binding protein 5.
26020772 2015 Level of Fatty Acid Binding Protein 5 (FABP5) Is Increased in Sputum of Allergic Asthmatics and Links to Airway Remodeling and Inflammation.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25797252 2015 CRABP-II- and FABP5-independent responsiveness of human glioblastoma cells to all-trans retinoic acid.
25027319 2014 Functional characterization of FABP3, 5 and 7 gene variants identified in schizophrenia and autism spectrum disorder and mouse behavioral studies.
24692551 2014 Structural basis for ligand regulation of the fatty acid-binding protein 5, peroxisome proliferator-activated receptor ?/? (FABP5-PPAR?/?) signaling pathway.
24244493 2013 A critical role of fatty acid binding protein 4 and 5 (FABP4/5) in the systemic response to fasting.
24189640 2014 The expression of C-FABP and PPAR? and their prognostic significance in prostate cancer.
More...