Property Summary

Ligand Count 14
NCBI Gene PubMed Count 68
PubMed Score 141.22
PubTator Score 87.97

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Carcinoma, Hepatocellular 228 0.0 0.0
Myocardial Ischemia 169 0.0 0.0
Disease Target Count
Liver carcinoma 240
Schizophrenia 1160
Disease Target Count P-value
psoriasis 6694 0.0e+00
Disease Target Count Z-score Confidence
Globe disease 67 0.0 3.0
Disease Target Count Z-score Confidence
Irritant dermatitis 9 3.483 1.7
Cancer 2499 3.227 1.6

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis 3.700 0.0e+00

Gene RIF (45)

AA Sequence

MATVQQLEGRWRLVDSKGFDEYMKELGVGIALRKMGAMAKPDCIITCDGKNLTIKTESTLKTTQFSCTLG      1 - 70
EKFEETTADGRKTQTVCNFTDGALVQHQEWDGKESTITRKLKDGKLVVECVMNNVTCTRIYEKVE          71 - 135
//

Text Mined References (76)

PMID Year Title