Property Summary

NCBI Gene PubMed Count 12
PubMed Score 173.40
PubTator Score 67.11

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
posterior fossa group A ependymoma 1511 1.13794430535526E-6
pilocytic astrocytoma 3086 5.82659121929412E-6
ovarian cancer 8492 8.05032170149607E-6
atypical teratoid / rhabdoid tumor 4369 3.35399816259472E-5
pediatric high grade glioma 2712 3.21398224640698E-4
group 3 medulloblastoma 2254 4.02775084943007E-4
glioblastoma 5572 0.00167676118004026
lung cancer 4473 0.00851640504630492
subependymal giant cell astrocytoma 2287 0.0172025519669031
Rheumatoid Arthritis 1171 0.034766306977591
pancreatic ductal adenocarcinoma liver metastasis 1795 0.0398912074924872
Disease Target Count Z-score Confidence
pre-eclampsia 67 3.987 2.0
beta-mannosidosis 9 3.519 1.8
Dystonia 77 3.325 1.7

Expression

Synonym

Accession Q01459 Q5VX50
Symbols CTB

Gene

PANTHER Protein Class (2)

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG
Xenopus OMA Inparanoid

Gene RIF (2)

PMID Text
26768631 Data indicate that infliximab changes the concentration of hexosaminidase (N-acetyl-beta-glucosaminidase; HEX) activity depending on the drug dose and time of administration.
16794344 biochemical behavior of di-N-acetylchitobiase indicates it has three subsites, -2, -1, +1, in which the reducing-end trimer of any sized chitooligosaccharide is bound. The +1 site is specific for an alpha-anomer.

AA Sequence

MSRPQLRRWRLVSSPPSGVPGLALLALLALLALRLAAGTDCPCPEPELCRPIRHHPDFEVFVFDVGQKTW      1 - 70
KSYDWSQITTVATFGKYDSELMCYAHSKGARVVLKGDVSLKDIIDPAFRASWIAQKLNLAKTQYMDGINI     71 - 140
DIEQEVNCLSPEYDALTALVKETTDSFHREIEGSQVTFDVAWSPKNIDRRCYNYTGIADACDFLFVMSYD    141 - 210
EQSQIWSECIAAANAPYNQTLTGYNDYIKMSINPKKLVMGVPWYGYDYTCLNLSEDHVCTIAKVPFRGAP    211 - 280
CSDAAGRQVPYKTIMKQINSSISGNLWDKDQRAPYYNYKDPAGHFHQVWYDNPQSISLKATYIQNYRLRG    281 - 350
IGMWNANCLDYSGDAVAKQQTEEMWEVLKPKLLQR                                       351 - 385
//

Text Mined References (15)

PMID Year Title
26768631 Fibroblast-Like Synovial Cells in Rheumatoid Arthritis--the Impact of Infliximab on Hexosaminidase Activity.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
19159218 2009 Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.
16794344 2006 Optimum substrate size and specific anomer requirements for the reducing-end glycoside hydrolase di-N-acetylchitobiase.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16502470 2006 Human colostrum: identification of minor proteins in the aqueous phase by proteomics.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11907625 2002 N-acetyl beta-D-glucosaminidase is not attached to human sperm membranes through the glycosylphosphatidyl inositol (GPI)-anchor.
10336991 1999 Structure of the human gene for lysosomal di-N-acetylchitobiase.
More...