Property Summary

NCBI Gene PubMed Count 12
PubMed Score 196.40
PubTator Score 67.11

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
adult high grade glioma 1.100 5.3e-03
Astrocytoma, Pilocytic 1.500 1.3e-05
atypical teratoid / rhabdoid tumor 1.500 3.4e-05
ependymoma 1.100 2.0e-05
glioblastoma 1.100 1.3e-03
group 3 medulloblastoma 1.400 4.0e-04
lung cancer -1.300 8.5e-03
ovarian cancer 1.900 8.1e-06
pancreatic ductal adenocarcinoma liver m... -1.025 4.0e-02
Rheumatoid arthritis 1.600 3.5e-02
subependymal giant cell astrocytoma 1.063 1.7e-02

Synonym

Accession Q01459 Q5VX50
Symbols CTB

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (2)

AA Sequence

MSRPQLRRWRLVSSPPSGVPGLALLALLALLALRLAAGTDCPCPEPELCRPIRHHPDFEVFVFDVGQKTW      1 - 70
KSYDWSQITTVATFGKYDSELMCYAHSKGARVVLKGDVSLKDIIDPAFRASWIAQKLNLAKTQYMDGINI     71 - 140
DIEQEVNCLSPEYDALTALVKETTDSFHREIEGSQVTFDVAWSPKNIDRRCYNYTGIADACDFLFVMSYD    141 - 210
EQSQIWSECIAAANAPYNQTLTGYNDYIKMSINPKKLVMGVPWYGYDYTCLNLSEDHVCTIAKVPFRGAP    211 - 280
CSDAAGRQVPYKTIMKQINSSISGNLWDKDQRAPYYNYKDPAGHFHQVWYDNPQSISLKATYIQNYRLRG    281 - 350
IGMWNANCLDYSGDAVAKQQTEEMWEVLKPKLLQR                                       351 - 385
//

Text Mined References (15)

PMID Year Title