Property Summary

NCBI Gene PubMed Count 10
PubMed Score 5.20
PubTator Score 14.07

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Cardiomyopathy, Hypertrophic 24 0.0 0.0
Disease Target Count
Hypertrophic Cardiomyopathy 117

Expression

Gene RIF (3)

AA Sequence

MASRKAGTRGKVAATKQAQRGSSNVFSMFEQAQIQEFKEAFSCIDQNRDGIICKADLRETYSQLGKVSVP      1 - 70
EEELDAMLQEGKGPINFTVFLTLFGEKLNGTDPEEAILSAFRMFDPSGKGVVNKDEFKQLLLTQADKFSP     71 - 140
AEVEQMFALTPMDLAGNIDYKSLCYIITHGDEKEE                                       141 - 175
//

Text Mined References (11)

PMID Year Title