Property Summary

NCBI Gene PubMed Count 10
PubMed Score 3.55
PubTator Score 14.07

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Expression

Synonym

Accession Q01449 B2R4L3 MLC-2a
Symbols MYL2A
MYLC2A

Gene

Gene RIF (3)

PMID Text
19794400 Treatment of human brain endothelial cells with Tat markedly elevates GTP-RhoA levels and the potential downstream effectors, such as myosin phosphatase target subunit 1 and myosin light chain
18718080 Dominant-negative effect of NMMHC-IIA is involved in the formation of inclusion bodies in Fechtner syndrome.
12847096 Nonmuscle Myosin Type IIA has distinct enzymatic properties that may be of importance in carrying out its cellular functions

AA Sequence

MASRKAGTRGKVAATKQAQRGSSNVFSMFEQAQIQEFKEAFSCIDQNRDGIICKADLRETYSQLGKVSVP      1 - 70
EEELDAMLQEGKGPINFTVFLTLFGEKLNGTDPEEAILSAFRMFDPSGKGVVNKDEFKQLLLTQADKFSP     71 - 140
AEVEQMFALTPMDLAGNIDYKSLCYIITHGDEKEE                                       141 - 175
//

Text Mined References (11)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
18718080 2008 [Expression and function of non-muscle myosin-IIA in Fechtner syndrome].
15621049 2005 Key role of myosin light chain (MLC) kinase-mediated MLC2a phosphorylation in the alpha 1-adrenergic positive inotropic effect in human atrium.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12847096 2003 Functional divergence of human cytoplasmic myosin II: kinetic characterization of the non-muscle IIA isoform.
12757876 2003 The human adult cardiomyocyte phenotype.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12083776 2002 An extra human chromosome 21 reduces mlc-2a expression in chimeric mice and Down syndrome.
8207020 1994 Chamber specification of atrial myosin light chain-2 expression precedes septation during murine cardiogenesis.
More...