Property Summary

Ligand Count 25
NCBI Gene PubMed Count 23
PubMed Score 67.55
PubTator Score 145.67

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
acute quadriplegic myopathy 1.549 3.0e-06
atypical teratoid / rhabdoid tumor -1.600 7.9e-05
autosomal dominant Emery-Dreifuss muscul... 1.063 1.3e-02
colon cancer 1.100 1.2e-03
cystic fibrosis 1.682 1.4e-03
group 3 medulloblastoma -2.000 3.0e-03
intraductal papillary-mucinous carcinoma... 1.600 1.5e-03
intraductal papillary-mucinous neoplasm ... 1.800 5.2e-03
invasive ductal carcinoma 1.981 2.3e-03
juvenile dermatomyositis 1.544 1.5e-09
malignant mesothelioma -5.600 7.1e-09
medulloblastoma, large-cell -1.200 4.6e-03
osteosarcoma -3.098 4.4e-05
ovarian cancer -1.500 4.1e-08
Pick disease -1.100 2.7e-03
progressive supranuclear palsy -1.400 1.6e-02
psoriasis 1.500 8.5e-04
tuberculosis -2.400 4.0e-08

Protein-protein Interaction (1)

Gene RIF (6)

AA Sequence

MPRQFPKLNISEVDEQVRLLAEKVFAKVLREEDSKDALSLFTVPEDCPIGQKEAKERELQKELAEQKSVE      1 - 70
TAKRKKSFKMIRSQSLSLQMPPQQDWKGPPAASPAMSPTTPVVTGATSLPTPAPYAMPEFQRVTISGDYC     71 - 140
AGITLEDYEQAAKSLAKALMIREKYARLAYHRFPRITSQYLGHPRADTAPPEEGLPDFHPPPLPQEDPYC    141 - 210
LDDAPPNLDYLVHMQGGILFVYDNKKMLEHQEPHSLPYPDLETYTVDMSHILALITDGPTKTYCHRRLNF    211 - 280
LESKFSLHEMLNEMSEFKELKSNPHRDFYNVRKVDTHIHAAACMNQKHLLRFIKHTYQTEPDRTVAEKRG    281 - 350
RKITLRQVFDGLHMDPYDLTVDSLDVHAGRQTFHRFDKFNSKYNPVGASELRDLYLKTENYLGGEYFARM    351 - 420
VKEVARELEESKYQYSEPRLSIYGRSPEEWPNLAYWFIQHKVYSPNMRWIIQVPRIYDIFRSKKLLPNFG    421 - 490
KMLENIFLPLFKATINPQDHRELHLFLKYVTGFDSVDDESKHSDHMFSDKSPNPDVWTSEQNPPYSYYLY    491 - 560
YMYANIMVLNNLRRERGLSTFLFRPHCGEAGSITHLVSAFLTADNISHGLLLKKSPVLQYLYYLAQIPIA    561 - 630
MSPLSNNSLFLEYSKNPLREFLHKGLHVSLSTDDPMQFHYTKEALMEEYAIAAQVWKLSTCDLCEIARNS    631 - 700
VLQSGLSHQEKQKFLGQNYYKEGPEGNDIRKTNVAQIRMAFRYETLCNELSFLSDAMKSEEITALTN       701 - 767
//

Text Mined References (29)

PMID Year Title