Property Summary

NCBI Gene PubMed Count 9
PubMed Score 17.15
PubTator Score 7.28

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Protein-protein Interaction (8)

Gene RIF (3)

AA Sequence

MATESPATRRVQVAEHPRLLKLKEMFNSKFGSIPKFYVRAPGRVNIIGEHIDYCGYSVLPMAVEQDVLIA      1 - 70
VEPVKTYALQLANTNPLYPDFSTSANNIQIDKTKPLWHNYFLCGLKGIQEHFGLSNLTGMNCLVDGNIPP     71 - 140
SSGLSSSSALVCCAGLVTLTVLGRNLSKVELAEICAKSERYIGTEGGGMDQSISFLAEEGTAKLIEFSPL    141 - 210
RATDVKLPSGAVFVIANSCVEMNKAATSHFNIRVMECRLAAKLLAKYKSLQWDKVLRLEEVQAKLGISLE    211 - 280
EMLLVTEDALHPEPYNPEEICRCLGISLEELRTQILSPNTQDVLIFKLYQRAKHVYSEAARVLQFKKICE    281 - 350
EAPENMVQLLGELMNQSHMSCRDMYECSCPELDQLVDICRKFGAQGSRLTGAGWGGCTVSMVPADKLPSF    351 - 420
LANVHKAYYQRSDGSLAPEKQSLFATKPGGGALVLLEA                                    421 - 458
//

Text Mined References (11)

PMID Year Title