Property Summary

NCBI Gene PubMed Count 9
PubMed Score 16.06
PubTator Score 7.28

Knowledge Summary

Patent

No data available

Expression

Gene RIF (3)

PMID Text
19874134 GALK2 has an ordered ternary complex mechanism in which ATP is the first substrate to bind
19874134 Kinetic studies suggest an ordered ternary complex mechanism in which ATP is the first substrate to bind.
16006554 geometry and substrate specificity of the GalNAc kinase active site before and after catalysis

AA Sequence

MATESPATRRVQVAEHPRLLKLKEMFNSKFGSIPKFYVRAPGRVNIIGEHIDYCGYSVLPMAVEQDVLIA      1 - 70
VEPVKTYALQLANTNPLYPDFSTSANNIQIDKTKPLWHNYFLCGLKGIQEHFGLSNLTGMNCLVDGNIPP     71 - 140
SSGLSSSSALVCCAGLVTLTVLGRNLSKVELAEICAKSERYIGTEGGGMDQSISFLAEEGTAKLIEFSPL    141 - 210
RATDVKLPSGAVFVIANSCVEMNKAATSHFNIRVMECRLAAKLLAKYKSLQWDKVLRLEEVQAKLGISLE    211 - 280
EMLLVTEDALHPEPYNPEEICRCLGISLEELRTQILSPNTQDVLIFKLYQRAKHVYSEAARVLQFKKICE    281 - 350
EAPENMVQLLGELMNQSHMSCRDMYECSCPELDQLVDICRKFGAQGSRLTGAGWGGCTVSMVPADKLPSF    351 - 420
LANVHKAYYQRSDGSLAPEKQSLFATKPGGGALVLLEA                                    421 - 458
//

Text Mined References (11)

PMID Year Title
21269460 2011 Initial characterization of the human central proteome.
19874134 2010 Mechanistic studies on human N-acetylgalactosamine kinase.
16572171 2006 Analysis of the DNA sequence and duplication history of human chromosome 15.
16006554 2005 The molecular architecture of human N-acetylgalactosamine kinase.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8798585 1996 Identification of the GalNAc kinase amino acid sequence.
8702831 1996 Kidney N-acetylgalactosamine (GalNAc)-1-phosphate kinase, a new pathway of GalNAc activation.
7542884 1995 Comparison of the enzymatic activities of human galactokinase GALK1 and a related human galactokinase protein GK2.
More...