Property Summary

NCBI Gene PubMed Count 103
PubMed Score 1135.09
PubTator Score 79.47

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
Atopic dermatitis -1.900 1.6e-03
invasive ductal carcinoma 1.089 6.9e-04
lung adenocarcinoma -1.500 1.2e-07
lung cancer -1.200 1.3e-03
lung carcinoma -1.100 2.8e-03
non-small cell lung cancer -2.035 1.3e-23
osteosarcoma -2.876 1.1e-07
uncontrolled asthma 1.200 6.7e-04

Synonym

Accession Q01362 Q54A81 FcERI
Symbols APY
IGEL
IGER
ATOPY
FCERI
IGHER
MS4A1
FCER1B

Gene

PANTHER Protein Class (1)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (82)

AA Sequence

MDTESNRRANLALPQEPSSVPAFEVLEISPQEVSSGRLLKSASSPPLHTWLTVLKKEQEFLGVTQILTAM      1 - 70
ICLCFGTVVCSVLDISHIEGDIFSSFKAGYPFWGAIFFSISGMLSIISERRNATYLVRGSLGANTASSIA     71 - 140
GGTGITILIINLKKSLAYIHIHSCQKFFETKCFMASFSTEIVVMMLFLTILGLGSAVSLTICGAGEELKG    141 - 210
NKVPEDRVYEELNIYSATYSELEDPGEMSPPIDL                                        211 - 244
//

Text Mined References (103)

PMID Year Title