Property Summary

NCBI Gene PubMed Count 102
Grant Count 86
R01 Count 46
Funding $21,428,486.91
PubMed Score 1086.14
PubTator Score 79.47

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
uncontrolled asthma 1.200 0.001
osteosarcoma -2.876 0.000
Atopic dermatitis -1.900 0.002
non-small cell lung cancer -2.035 0.000
lung cancer -2.600 0.000
lung adenocarcinoma -1.700 0.000
invasive ductal carcinoma 1.089 0.001
lung carcinoma -1.100 0.003

Synonym

Accession Q01362 Q54A81 FcERI
Symbols APY
IGEL
IGER
ATOPY
FCERI
IGHER
MS4A1
FCER1B

Gene

PANTHER Protein Class (1)

Gene RIF (81)

PMID Text
27157394 MS4A2 was differentially expressed between Fibromyalgia patients and healthy controls.
25658351 The results explain how initial membrane interactions of clustered IgE-Fcepsilon RI complexes lead to downstream cellular responses.
25530133 FcepsilonRIbeta -109C/T and IFN-gamma 874T/A polymorphisms may be influencing factors for asthma in the Asian population
24981302 study found a difference in the frequencies of genotypes of FcvarepsilonRIbeta subunit int 2 in allergic rhinitis patients and controls. The FcvarepsilonRIbeta subunit int 2 gene polymorphism was found to be associated with allergic rhinitis in the Polish cohort
24953255 no association between gene polymorphism and chronic spontaneous urticaria in Kashmiri population
24495860 Data indicated that the MS4A2 gene E237G variant may be a risk factor for developing atopic asthma and the promoter -109T allele is a potential risk factor of asthma in Asians.
24118172 Cytoplasmic FcepsilonRIbeta, which is not co-localized with FcepsilonRIalpha, may function as a negative regulator, as it can capture important signalling molecules such as Lyn.
23643722 t-FcepsilonRIbeta mediates Ca2+ -dependent microtubule formation, which promotes degranulation and cytokine release.
22845063 The interaction between Lyn and FcepsilonRIbeta is indispensable for FcepsilonRI-mediated human mast cell activation.
22150093 Demethylation of specific regulatory elements within the FCER1G locus contributes to FcepsilonRI overexpression on monocytes from patients with atopic dermatitis.
More...

AA Sequence

MDTESNRRANLALPQEPSSVPAFEVLEISPQEVSSGRLLKSASSPPLHTWLTVLKKEQEFLGVTQILTAM      1 - 70
ICLCFGTVVCSVLDISHIEGDIFSSFKAGYPFWGAIFFSISGMLSIISERRNATYLVRGSLGANTASSIA     71 - 140
GGTGITILIINLKKSLAYIHIHSCQKFFETKCFMASFSTEIVVMMLFLTILGLGSAVSLTICGAGEELKG    141 - 210
NKVPEDRVYEELNIYSATYSELEDPGEMSPPIDL                                        211 - 244
//

Text Mined References (102)

PMID Year Title
27157394 Genome-wide expression profiling in the peripheral blood of patients with fibromyalgia.
25658351 2015 Nanodomains in early and later phases of Fc?RI signalling.
25530133 2015 Association between Fc?RI? and IFN-? Polymorphisms and Asthma in Asian Population: a Meta-Analysis.
24981302 High-affinity IgE receptor gene polymorphism and allergic rhinitis in a Polish population.
24953255 IgE Fc?R1? polymorphism and risk of developing chronic spontaneous urticaria: A study in an ethnic Kashmiri population.
24495860 2014 Association of the MS4A2 gene promoter C-109T or the 7th exon E237G polymorphisms with asthma risk: a meta-analysis.
24118172 2014 Highly expressed cytoplasmic Fc?RI? in human mast cells functions as a negative regulator of the FcR?-mediated cell activation signal.
23643722 2013 A truncated splice-variant of the Fc?RI? receptor subunit is critical for microtubule formation and degranulation in mast cells.
22845063 2012 The interaction between Lyn and Fc?RI? is indispensable for Fc?RI-mediated human mast cell activation.
22150093 2012 Demethylation of the FCER1G promoter leads to Fc?RI overexpression on monocytes of patients with atopic dermatitis.
More...