Property Summary

NCBI Gene PubMed Count 78
Grant Count 46
R01 Count 23
Funding $2,550,091.55
PubMed Score 32.18
PubTator Score 101.42

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
osteosarcoma -1.952 0.000
lung adenocarcinoma -1.500 0.000
posterior fossa group B ependymoma 1.700 0.000
lung carcinoma -2.100 0.000
non-small cell lung carcinoma -1.300 0.000

Gene RIF (56)

PMID Text
25523412 This is the first study to show significant associations between IL5RA SNP rs17881144, the ATTAGA haplotype, the GTAGCA haplotype, and the GCTGCA haplotype and eczema.
24332579 This is the first study to show significant associations between IL5RA SNP rs6771148, the ACTAGA haplotype, and the GTAGCA haplotype and the risk of rhinoconjunctivitis.
23470716 These findings suggest that a functional polymorphism in IL5RA may contribute to eosinophil and mast cell activation along with specific IgE responses to staphylococcal enterotoxin A in aspirin-exacerbated respiratory disease patients.
23190752 The MDR analysis showed a potential interaction of C1GALT1-330G/T (rs1008898) and IL5RA31+197A/G (rs340833) on the susceptibility of IgAN (P<0.001). Gene-gene interaction may have some influence on the susceptibility to IgA nephropathy.
22528658 The study reports the crystal structure of dimeric IL-5 in complex with the IL5RA extracellular domains.
22153509 we determined the structure of IL-5 bound to the extracellular domain of IL-5Ralpha.
21986312 REVIEW: Interleukin-5 and IL-5 receptor in health and disease
21770429 Study of engineered deglycosylated IL-5 receptor alpha variant proves that unique carbohydrate groups in multiglycosylated receptors can be utilized asymmetrically for function.
21762978 IL-5Ralpha expression on eosinophils inversely correlated with eosinophilia and was significantly elevated in patients with systemic mastocytosis without eosinophilia
21193198 Polymorphisms in IL5RA, LPL, ITGA2 and NOS3 genes were independently associated with ischemic stroke in Chinese diabetic population.
More...

AA Sequence

MIIVAHVLLILLGATEILQADLLPDEKISLLPPVNFTIKVTGLAQVLLQWKPNPDQEQRNVNLEYQVKIN      1 - 70
APKEDDYETRITESKCVTILHKGFSASVRTILQNDHSLLASSWASAELHAPPGSPGTSIVNLTCTTNTTE     71 - 140
DNYSRLRSYQVSLHCTWLVGTDAPEDTQYFLYYRYGSWTEECQEYSKDTLGRNIACWFPRTFILSKGRDW    141 - 210
LAVLVNGSSKHSAIRPFDQLFALHAIDQINPPLNVTAEIEGTRLSIQWEKPVSAFPIHCFDYEVKIHNTR    211 - 280
NGYLQIEKLMTNAFISIIDDLSKYDVQVRAAVSSMCREAGLWSEWSQPIYVGNDEHKPLREWFVIVIMAT    281 - 350
ICFILLILSLICKICHLWIKLFPPIPAPKSNIKDLFVTTNYEKAGSSETEIEVICYIEKPGVETLEDSVF    351 - 420
//

Text Mined References (81)

PMID Year Title
25523412 2015 IL5RA polymorphisms, smoking and eczema in Japanese women: the Kyushu Okinawa Maternal and Child Health Study.
24332579 2014 Case-control study of rhinoconjunctivitis associated with IL5RA polymorphisms in Japanese women: the Kyushu Okinawa Maternal and Child Health Study.
23470716 2013 A genetic effect of IL-5 receptor ? polymorphism in patients with aspirin-exacerbated respiratory disease.
23362303 2013 Genome-wide association study identifies novel loci associated with concentrations of four plasma phospholipid fatty acids in the de novo lipogenesis pathway: results from the Cohorts for Heart and Aging Research in Genomic Epidemiology (CHARGE) consortium.
23190752 2013 Interaction of C1GALT1-IL5RA on the susceptibility to IgA nephropathy in Southern Han Chinese.
23166209 2012 Impact of ancestry and common genetic variants on QT interval in African Americans.
22560479 2012 Genome-wide association study of the age of onset of childhood asthma.
22542470 2012 Genome-wide association study of antibody response to smallpox vaccine.
22528658 2012 Structural basis of interleukin-5 dimer recognition by its ? receptor.
22153509 2011 Structure analysis of the IL-5 ligand-receptor complex reveals a wrench-like architecture for IL-5R?.
More...