Property Summary

Ligand Count 1
NCBI Gene PubMed Count 79
PubMed Score 35.78
PubTator Score 101.42

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Abortion, Spontaneous 109 0.0 0.0
Hypersensitivity 63 0.0 0.0
Pneumonia 174 0.0 0.0
Disease Target Count
Spontaneous abortion 113
Disease Target Count
Eosinophilic asthma 6
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
Heart conduction disease 83 0.0 1.4
Disease Target Count Z-score Confidence
Asthma 385 4.059 2.0
Hypereosinophilic syndrome 71 3.466 1.7

Expression

  Differential Expression (5)

Disease log2 FC p
lung adenocarcinoma -1.100 1.2e-05
lung carcinoma -2.100 7.1e-12
non-small cell lung carcinoma -1.300 7.6e-16
osteosarcoma -1.952 7.0e-08
posterior fossa group B ependymoma 1.700 5.9e-09

 CSPA Cell Line (1)

Protein-protein Interaction (9)

Gene RIF (57)

AA Sequence

MIIVAHVLLILLGATEILQADLLPDEKISLLPPVNFTIKVTGLAQVLLQWKPNPDQEQRNVNLEYQVKIN      1 - 70
APKEDDYETRITESKCVTILHKGFSASVRTILQNDHSLLASSWASAELHAPPGSPGTSIVNLTCTTNTTE     71 - 140
DNYSRLRSYQVSLHCTWLVGTDAPEDTQYFLYYRYGSWTEECQEYSKDTLGRNIACWFPRTFILSKGRDW    141 - 210
LAVLVNGSSKHSAIRPFDQLFALHAIDQINPPLNVTAEIEGTRLSIQWEKPVSAFPIHCFDYEVKIHNTR    211 - 280
NGYLQIEKLMTNAFISIIDDLSKYDVQVRAAVSSMCREAGLWSEWSQPIYVGNDEHKPLREWFVIVIMAT    281 - 350
ICFILLILSLICKICHLWIKLFPPIPAPKSNIKDLFVTTNYEKAGSSETEIEVICYIEKPGVETLEDSVF    351 - 420
//

Text Mined References (82)

PMID Year Title