Property Summary

NCBI Gene PubMed Count 143
Grant Count 200
R01 Count 121
Funding $16,985,980.15
PubMed Score 275.48
PubTator Score 153.63

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
psoriasis 1.300 0.000
tuberculosis -1.200 0.003
interstitial cystitis 1.300 0.001

Synonym

Accession Q01201 Q6GTX7 Q9UEI7
Symbols IREL
I-REL
REL-B

Gene

PANTHER Protein Class (1)

Gene RIF (133)

PMID Text
26914709 Lung-specific (CC-16) and novel (RelB) biomarkers are associated with systemic cardiovascular changes over time.
26463648 In conclusion, DECs show a unique hypo-responsive phenotype to the pro-inflammatory stimulus LPS in order to control the inflammatory response at feto-maternal interface.
26455434 HDAC4-RelB-p52 complex maintains repressive chromatin around proapoptotic genes Bim and BMF and regulates multiple myeloma survival and growth
26385063 the role of RelB on lymphocyte development in humans was shown.
26321231 Knockdown of ADGRG2 breast cancer cell lines resulted in a strong reduction in cell adhesion and subsequent cell migration which was associated with a selective reduction in RelB.
26307012 results suggest that glucocorticoids induce a transcription complex consisting of RelB/p52, CBP, and HDAC1 that triggers a dynamic acetylation-mediated epigenetic change to induce CRH expression in full-term human placenta.
26186215 Although RelB nuclear frequency alone did not predict recurrence, the presence of activated RelB reduced the risk of recurrence associated with the activation of p65.
26147201 In non-small cell lung cancer, RelB expression was identified in proliferating tumor cells. tumor RelB expression was an independent predictor of lymph node metastasis
25943190 Basal expression of RelB was significantly lower in lung cells derived from smokers with and without COPD.
25794352 RELB enhances proliferation of human-induced pluripotent stem cells without affecting their pluripotency. RELB interacts with LIN28A and IMP3.
More...

AA Sequence

MLRSGPASGPSVPTGRAMPSRRVARPPAAPELGALGSPDLSSLSLAVSRSTDELEIIDEYIKENGFGLDG      1 - 70
GQPGPGEGLPRLVSRGAASLSTVTLGPVAPPATPPPWGCPLGRLVSPAPGPGPQPHLVITEQPKQRGMRF     71 - 140
RYECEGRSAGSILGESSTEASKTLPAIELRDCGGLREVEVTACLVWKDWPHRVHPHSLVGKDCTDGICRV    141 - 210
RLRPHVSPRHSFNNLGIQCVRKKEIEAAIERKIQLGIDPYNAGSLKNHQEVDMNVVRICFQASYRDQQGQ    211 - 280
MRRMDPVLSEPVYDKKSTNTSELRICRINKESGPCTGGEELYLLCDKVQKEDISVVFSRASWEGRADFSQ    281 - 350
ADVHRQIAIVFKTPPYEDLEIVEPVTVNVFLQRLTDGVCSEPLPFTYLPRDHDSYGVDKKRKRGMPDVLG    351 - 420
ELNSSDPHGIESKRRKKKPAILDHFLPNHGSGPFLPPSALLPDPDFFSGTVSLPGLEPPGGPDLLDDGFA    421 - 490
YDPTAPTLFTMLDLLPPAPPHASAVVCSGGAGAVVGETPGPEPLTLDSYQAPGPGDGGTASLVGSNMFPN    491 - 560
HYREAAFGGGLLSPGPEAT                                                       561 - 579
//

Text Mined References (151)

PMID Year Title
26914709 2016 Club Cell-16 and RelB as Novel Determinants of Arterial Stiffness in Exacerbating COPD Patients.
26463648 2015 RelB activation in anti-inflammatory decidual endothelial cells: a master plan to avoid pregnancy failure?
26455434 2015 Transcriptional repression by the HDAC4-RelB-p52 complex regulates multiple myeloma survival and growth.
26385063 2015 The effects of RelB deficiency on lymphocyte development and function.
26321231 2015 The adhesion G protein-coupled receptor G2 (ADGRG2/GPR64) constitutively activates SRE and NF?B and is involved in cell adhesion and migration.
26307012 2015 RelB/p52-mediated NF-?B signaling alters histone acetylation to increase the abundance of corticotropin-releasing hormone in human placenta.
26186215 2015 Potential Cross-Talk between Alternative and Classical NF-?B Pathways in Prostate Cancer Tissues as Measured by a Multi-Staining Immunofluorescence Co-Localization Assay.
26147201 2015 Comprehensive Evaluation of Nuclear Factor-?? Expression Patterns in Non-Small Cell Lung Cancer.
25943190 2015 Decreased expression of the NF-?B family member RelB in lung fibroblasts from Smokers with and without COPD potentiates cigarette smoke-induced COX-2 expression.
25794352 2015 RELB Alters Proliferation of Human Pluripotent Stem Cells via IMP3- and LIN28-Mediated Modulation of the Expression of IGF2 and Other Cell-Cycle Regulators.
More...