Property Summary

NCBI Gene PubMed Count 151
PubMed Score 292.22
PubTator Score 153.63

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Heat Stroke 13 0.0 0.0
Disease Target Count P-value
psoriasis 6694 3.3e-04
interstitial cystitis 2312 6.8e-04
tuberculosis 2010 2.6e-03
Disease Target Count Z-score Confidence
Cancer 2499 4.107 2.1

Expression

  Differential Expression (3)

Disease log2 FC p
interstitial cystitis 1.300 6.8e-04
psoriasis 1.300 3.3e-04
tuberculosis -1.200 2.6e-03

 GWAS Trait (1)

Gene RIF (137)

AA Sequence

MLRSGPASGPSVPTGRAMPSRRVARPPAAPELGALGSPDLSSLSLAVSRSTDELEIIDEYIKENGFGLDG      1 - 70
GQPGPGEGLPRLVSRGAASLSTVTLGPVAPPATPPPWGCPLGRLVSPAPGPGPQPHLVITEQPKQRGMRF     71 - 140
RYECEGRSAGSILGESSTEASKTLPAIELRDCGGLREVEVTACLVWKDWPHRVHPHSLVGKDCTDGICRV    141 - 210
RLRPHVSPRHSFNNLGIQCVRKKEIEAAIERKIQLGIDPYNAGSLKNHQEVDMNVVRICFQASYRDQQGQ    211 - 280
MRRMDPVLSEPVYDKKSTNTSELRICRINKESGPCTGGEELYLLCDKVQKEDISVVFSRASWEGRADFSQ    281 - 350
ADVHRQIAIVFKTPPYEDLEIVEPVTVNVFLQRLTDGVCSEPLPFTYLPRDHDSYGVDKKRKRGMPDVLG    351 - 420
ELNSSDPHGIESKRRKKKPAILDHFLPNHGSGPFLPPSALLPDPDFFSGTVSLPGLEPPGGPDLLDDGFA    421 - 490
YDPTAPTLFTMLDLLPPAPPHASAVVCSGGAGAVVGETPGPEPLTLDSYQAPGPGDGGTASLVGSNMFPN    491 - 560
HYREAAFGGGLLSPGPEAT                                                       561 - 579
//

Text Mined References (158)

PMID Year Title