Property Summary

NCBI Gene PubMed Count 583
PubMed Score 1899.26
PubTator Score 1284.42

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Cancer 2499 6.241 3.1
Disease Target Count Z-score Confidence
Cleidocranial dysplasia 10 4.1 2.1
Down syndrome 499 3.98 2.0

Expression

  Differential Expression (24)

Disease log2 FC p
glioblastoma 2.000 2.3e-08
acute quadriplegic myopathy 1.984 1.1e-06
adult high grade glioma 1.500 4.7e-04
Amyotrophic lateral sclerosis 1.143 2.6e-05
Astrocytoma, Pilocytic 2.300 1.0e-09
chronic kidney disease 1.300 1.7e-02
colon cancer 1.400 3.8e-02
COPD -1.100 2.0e-03
ependymoma 1.300 5.7e-05
fibroadenoma 2.200 2.6e-03
gastric carcinoma 1.300 3.4e-02
inflammatory breast cancer -1.700 3.4e-05
intraductal papillary-mucinous adenoma (... 2.600 7.3e-03
intraductal papillary-mucinous carcinoma... 1.500 3.5e-02
intraductal papillary-mucinous neoplasm ... 2.700 4.3e-04
lung adenocarcinoma 1.400 5.1e-07
lung cancer -1.100 1.9e-03
lung carcinoma -1.400 3.2e-21
osteosarcoma -2.690 3.9e-06
ovarian cancer 1.100 2.1e-12
pancreatic cancer 1.100 1.6e-03
pancreatic ductal adenocarcinoma liver m... 1.988 1.0e-02
subependymal giant cell astrocytoma 2.116 2.6e-03
tuberculosis and treatment for 3 months -1.100 1.6e-02

Protein-protein Interaction (5)

Gene RIF (521)

AA Sequence

MRIPVDASTSRRFTPPSTALSPGKMSEALPLGAPDAGAALAGKLRSGDRSMVEVLADHPGELVRTDSPNF      1 - 70
LCSVLPTHWRCNKTLPIAFKVVALGDVPDGTLVTVMAGNDENYSAELRNATAAMKNQVARFNDLRFVGRS     71 - 140
GRGKSFTLTITVFTNPPQVATYHRAIKITVDGPREPRRHRQKLDDQTKPGSLSFSERLSELEQLRRTAMR    141 - 210
VSPHHPAPTPNPRASLNHSTAFNPQPQSQMQDTRQIQPSPPWSYDQSYQYLGSIASPSVHPATPISPGRA    211 - 280
SGMTTLSAELSSRLSTAPDLTAFSDPRQFPALPSISDPRMHYPGAFTYSPTPVTSGIGIGMSAMGSATRY    281 - 350
HTYLPPPYPGSSQAQGGPFQASSPSYHLYYGASAGSYQFSMVGGERSPPRILPPCTNASTGSALLNPSLP    351 - 420
NQSDVVEAEGSHSNSPTNMAPSARLEEAVWRPY                                         421 - 453
//

Text Mined References (591)

PMID Year Title