Property Summary

NCBI Gene PubMed Count 515
PubMed Score 1788.99
PubTator Score 1284.42

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (8)

Disease Target Count P-value
lung carcinoma 2844 3.20181278447791E-21
pilocytic astrocytoma 3086 4.68726876204227E-10
posterior fossa group A ependymoma 1511 1.94838528665494E-7
lung adenocarcinoma 2714 5.08055810170214E-7
acute quadriplegic myopathy 1157 1.12749951168349E-6
osteosarcoma 7933 3.86700119280753E-6
ovarian cancer 8492 4.3592739224324E-6
pediatric high grade glioma 2712 7.51406738940897E-6
Amyotrophic Lateral Sclerosis 432 2.57815839163063E-5
inflammatory breast cancer 404 3.36449282899982E-5
intraductal papillary-mucinous neoplasm (IPMN) 3289 4.3168199713105E-4
colon cancer 1475 5.17945397998746E-4
pancreatic cancer 2300 8.45800937717595E-4
lung cancer 4473 0.00191150737715583
COPD 116 0.00202830150493543
fibroadenoma 557 0.00258785275075155
subependymal giant cell astrocytoma 2287 0.00259647063512195
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00290084631547693
pancreatic ductal adenocarcinoma liver metastasis 1795 0.0100516528460266
tuberculosis and treatment for 3 months 327 0.0162454030798659
chronic kidney disease 90 0.0172877896349464
gastric carcinoma 832 0.0339964727602861
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.0400108963887459
Disease Target Count Z-score Confidence
Hematologic cancer 9 0.0 1.0
Immune system cancer 38 0.0 1.0
Disease Target Count Z-score Confidence
Esophageal cancer 30 0.0 2.0
Disease Target Count Z-score Confidence
Rheumatoid Arthritis 1171 0.0 5.0
Disease Target Count Z-score Confidence
Cancer 2346 6.226 3.1
Disease Target Count Z-score Confidence
Cleidocranial dysplasia 10 4.126 2.1
Thrombocytopenia 105 3.778 1.9

Expression

Synonym

Accession Q01196 A8MV94 B2RMS4 D3DSG1 O60472 O60473 O76047 O76089 Q13081 Q13755 Q13756 Q13757 Q13758 Q13759 Q15341 Q15343 Q16122 Q16284 Q16285 Q16286 Q16346 Q16347 Q92479
Symbols AML1
CBFA2
EVI-1
AMLCR1
PEBP2aB
CBF2alpha
AML1-EVI-1
PEBP2alpha

Gene

PANTHER Protein Class (1)

PDB

1E50   1H9D   1CMO   1CO1   1LJM  

  Ortholog (8)

Gene RIF (455)

PMID Text
27100087 A statistically significant gain of methylation at CpG dinucleotide sites within the RUNX1 gene is observed in individuals with free trisomy 21 (Down syndrome) compared with control disomic samples. The gain is independent of the maternal or the paternal origin of the chromosome 21 nondisjunction event.
26990877 we observed that inhibition of RUNX1/ETO in Kasumi1 cells and in RUNX1/ETO positive primary acute myeloid leukemia patient samples leads to up-regulation of miR144/451
26916619 RUNX1 and ER occupy adjacent elements in AXIN1's second intron, and RUNX1 antagonizes oestrogen-mediated AXIN1 suppression.
26907657 RUNX1 amplification may predispose to early thrombotic events in children with B-cell acute lymphoblastic leukemia
26901859 in hematopoietic cells RUNX1 protein is recruited to its own promoter to regulate RUNX1 gene transcription in a positive feedback loop.
26852652 ETV6/RUNX1 transcript is a target of RNA-binding protein IGF2BP1 in t(12;21)(p13;q22)-positive acute lymphoblastic leukemia.
26849013 RUNX1 haploinsufficiency collaborates with genetic alterations conferring clonal advantage such as TET2 mutation or trisomy 21 to establish pre-leukemic state.
26745853 Runx1 haploinsufficiency appears to predispose FPD patients to MM by expanding the pool of stem/progenitor cells and blocking myeloid differentiation in response to G-CSF.
26716895 Low expression of RUNX1 is associated with malignant progression of gastric cancer.
26706127 Data suggest that biosynthesis and folding of leukemogenic fusion oncoprotein AML1-ETO/RUNX1-RUNX1T1 is facilitated by interaction with the chaperonin TRiC/CCT1/TCP1 and HSP70 (heat shock protein 70).
More...

AA Sequence

MRIPVDASTSRRFTPPSTALSPGKMSEALPLGAPDAGAALAGKLRSGDRSMVEVLADHPGELVRTDSPNF      1 - 70
LCSVLPTHWRCNKTLPIAFKVVALGDVPDGTLVTVMAGNDENYSAELRNATAAMKNQVARFNDLRFVGRS     71 - 140
GRGKSFTLTITVFTNPPQVATYHRAIKITVDGPREPRRHRQKLDDQTKPGSLSFSERLSELEQLRRTAMR    141 - 210
VSPHHPAPTPNPRASLNHSTAFNPQPQSQMQDTRQIQPSPPWSYDQSYQYLGSIASPSVHPATPISPGRA    211 - 280
SGMTTLSAELSSRLSTAPDLTAFSDPRQFPALPSISDPRMHYPGAFTYSPTPVTSGIGIGMSAMGSATRY    281 - 350
HTYLPPPYPGSSQAQGGPFQASSPSYHLYYGASAGSYQFSMVGGERSPPRILPPCTNASTGSALLNPSLP    351 - 420
NQSDVVEAEGSHSNSPTNMAPSARLEEAVWRPY                                         421 - 453
//

Text Mined References (523)

PMID Year Title
27100087 2016 Trisomy 21 Alters DNA Methylation in Parent-of-Origin-Dependent and -Independent Manners.
26990877 2016 MiR144/451 Expression Is Repressed by RUNX1 During Megakaryopoiesis and Disturbed by RUNX1/ETO.
26916619 2016 RUNX1 prevents oestrogen-mediated AXIN1 suppression and ?-catenin activation in ER-positive breast cancer.
26907657 2016 RUNX1 Amplification Increases the Risk for Thrombosis in Children With B-cell Acute Lymphoblastic Leukemia.
26901859 2016 Transcriptional Auto-Regulation of RUNX1 P1 Promoter.
26852652 2016 ETV6/RUNX1 transcript is a target of RNA-binding protein IGF2BP1 in t(12;21)(p13;q22)-positive acute lymphoblastic leukemia.
26849013 2016 Genetic basis of myeloid transformation in familial platelet disorder/acute myeloid leukemia patients with haploinsufficient RUNX1 allele.
26745853 2016 RUNX1 haploinsufficiency results in granulocyte colony-stimulating factor hypersensitivity.
26716895 2016 miR-215 promotes malignant progression of gastric cancer by targeting RUNX1.
26706127 2016 Chaperonin TRiC/CCT Modulates the Folding and Activity of Leukemogenic Fusion Oncoprotein AML1-ETO.
More...