Property Summary

NCBI Gene PubMed Count 24
PubMed Score 46.26
PubTator Score 20.10

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (7)

Disease log2 FC p
adrenocortical carcinoma -1.194 8.8e-04
atypical teratoid / rhabdoid tumor 1.300 1.5e-03
Breast cancer 1.300 2.2e-05
glioblastoma 1.500 1.8e-03
group 4 medulloblastoma 1.500 1.2e-04
medulloblastoma, large-cell 2.100 3.7e-06
ovarian cancer 1.400 8.5e-05

Gene RIF (10)

AA Sequence

MAAAAAALSGAGTPPAGGGAGGGGAGGGGSPPGGWAVARLEGREFEYLMKKRSVTIGRNSSQGSVDVSMG      1 - 70
HSSFISRRHLEIFTPPGGGGHGGAAPELPPAQPRPDAGGDFYLRCLGKNGVFVDGVFQRRGAPPLQLPRV     71 - 140
CTFRFPSTNIKITFTALSSEKREKQEASESPVKAVQPHISPLTINIPDTMAHLISPLPSPTGTISAANSC    141 - 210
PSSPRGAGSSGYKVGRVMPSDLNLMADNSQPENEKEASGGDSPKDDSKPPYSYAQLIVQAITMAPDKQLT    211 - 280
LNGIYTHITKNYPYYRTADKGWQNSIRHNLSLNRYFIKVPRSQEEPGKGSFWRIDPASESKLIEQAFRKR    281 - 350
RPRGVPCFRTPLGPLSSRSAPASPNHAGVLSAHSSGAQTPESLSREGSPAPLEPEPGAAQPKLAVIQEAR    351 - 420
FAQSAPGSPLSSQPVLITVQRQLPQAIKPVTYTVATPVTTSTSQPPVVQTVHVVHQIPAVSVTSVAGLAP    421 - 490
ANTYTVSGQAVVTPAAVLAPPKAEAQENGDHREVKVKVEPIPAIGHATLGTASRIIQTAQTTPVQTVTIV    491 - 560
QQAPLGQHQLPIKTVTQNGTHVASVPTAVHGQVNNAAASPLHMLATHASASASLPTKRHNGDQPEQPELK    561 - 630
RIKTEDGEGIVIALSVDTPPAAVREKGVQN                                            631 - 660
//

Text Mined References (36)

PMID Year Title