Property Summary

NCBI Gene PubMed Count 21
Grant Count 1
Funding $63,519.2
PubMed Score 42.49
PubTator Score 20.10

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.300 0.002
glioblastoma 1.500 0.002
group 4 medulloblastoma 1.500 0.000
medulloblastoma, large-cell 2.100 0.000
adrenocortical carcinoma -1.194 0.001
ovarian cancer 1.400 0.000
Breast cancer 1.300 0.000

Synonym

Accession Q01167 A6NEP5 Q13622 Q13623 Q13624
Symbols ILF
ILF1
ILF-1

Gene

 Grant Application (1)

PDB

1JXS   2C6Y  

Gene RIF (7)

PMID Text
26578569 FOXO3-dependent gene regulation is generally mediated not through uniquely bound regions but through regions occupied by both FOXK2 and FOXO3 where both factors play a regulatory role.
25805136 FOXK1 and FOXK2 positively regulate Wnt/beta-catenin signaling by translocating dishevelled proteins into the nucleus.
25740706 FOXK2 might act as a negative regulator of ERalpha, and its association with both ERalpha and BRCA1/BARD1 could lead to the down-regulation of ERalpha transcriptional activity, effectively regulating the function of ERalpha.
25451922 BAP1 deficiency causes increased expression of FoxK2 target genes in a Ring1B-Bmi1-dependent manner
22083952 FOXK2 can promote transcriptional activation and is required for the efficient recruitment of AP-1 components to chromatin.
20810654 Data show that FOXK2 is subject to control by cell cycle-regulated hyperphosphorylation occurring in CDK).cyclin-dependent manner with CDK1.cyclin B as the major kinase complex.
20097901 FOXK2 is a G/T-mismatch DNA-binding protein and a deaminated DNA-binding protein

AA Sequence

MAAAAAALSGAGTPPAGGGAGGGGAGGGGSPPGGWAVARLEGREFEYLMKKRSVTIGRNSSQGSVDVSMG      1 - 70
HSSFISRRHLEIFTPPGGGGHGGAAPELPPAQPRPDAGGDFYLRCLGKNGVFVDGVFQRRGAPPLQLPRV     71 - 140
CTFRFPSTNIKITFTALSSEKREKQEASESPVKAVQPHISPLTINIPDTMAHLISPLPSPTGTISAANSC    141 - 210
PSSPRGAGSSGYKVGRVMPSDLNLMADNSQPENEKEASGGDSPKDDSKPPYSYAQLIVQAITMAPDKQLT    211 - 280
LNGIYTHITKNYPYYRTADKGWQNSIRHNLSLNRYFIKVPRSQEEPGKGSFWRIDPASESKLIEQAFRKR    281 - 350
RPRGVPCFRTPLGPLSSRSAPASPNHAGVLSAHSSGAQTPESLSREGSPAPLEPEPGAAQPKLAVIQEAR    351 - 420
FAQSAPGSPLSSQPVLITVQRQLPQAIKPVTYTVATPVTTSTSQPPVVQTVHVVHQIPAVSVTSVAGLAP    421 - 490
ANTYTVSGQAVVTPAAVLAPPKAEAQENGDHREVKVKVEPIPAIGHATLGTASRIIQTAQTTPVQTVTIV    491 - 560
QQAPLGQHQLPIKTVTQNGTHVASVPTAVHGQVNNAAASPLHMLATHASASASLPTKRHNGDQPEQPELK    561 - 630
RIKTEDGEGIVIALSVDTPPAAVREKGVQN                                            631 - 660
//

Text Mined References (32)

PMID Year Title
26578569 2016 Genome-wide binding studies reveal DNA binding specificity mechanisms and functional interplay amongst Forkhead transcription factors.
25805136 2015 FOXKs promote Wnt/?-catenin signaling by translocating DVL into the nucleus.
25740706 2015 FOXK2 transcription factor suppresses ER?-positive breast cancer cell growth through down-regulating the stability of ER? via mechanism involving BRCA1/BARD1.
25609649 2015 Proteomic analyses reveal distinct chromatin-associated and soluble transcription factor complexes.
25451922 2015 BRCA1-associated protein 1 (BAP1) deubiquitinase antagonizes the ubiquitin-mediated activation of FoxK2 target genes.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22083952 2012 The forkhead transcription factor FOXK2 promotes AP-1-mediated transcriptional regulation.
More...