Property Summary

NCBI Gene PubMed Count 72
PubMed Score 636.68
PubTator Score 475.90

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
acute myeloid leukemia 1.300 2.5e-02
chronic lymphosyte leukemia -1.100 3.1e-04
cutaneous lupus erythematosus 1.900 1.6e-03
ependymoma -1.100 1.3e-02
gastric cancer -1.200 1.3e-02
hepatocellular carcinoma -1.700 8.1e-04
interstitial cystitis 1.500 8.8e-03
lung adenocarcinoma -1.190 7.5e-06
lung cancer -4.000 3.7e-05
lung carcinoma -1.700 6.2e-12
malignant mesothelioma 3.100 1.1e-08
mucosa-associated lymphoid tissue lympho... 1.296 4.6e-02
non-small cell lung cancer -2.101 4.6e-18
ovarian cancer 1.300 5.3e-05
pituitary cancer 1.600 7.3e-06
psoriasis 1.400 3.9e-86
ulcerative colitis 1.700 1.1e-04
Waldenstrons macroglobulinemia 1.128 3.5e-02

Gene RIF (67)

AA Sequence

MSRGLQLLLLSCAYSLAPATPEVKVACSEDVDLPCTAPWDPQVPYTVSWVKLLEGGEERMETPQEDHLRG      1 - 70
QHYHQKGQNGSFDAPNERPYSLKIRNTTSCNSGTYRCTLQDPDGQRNLSGKVILRVTGCPAQRKEETFKK     71 - 140
YRAEIVLLLALVIFYLTLIIFTCKFARLQSIFPDFSKAGMERAFLPVTSPNKHLGLVTPHKTELV         141 - 205
//

Text Mined References (75)

PMID Year Title