Property Summary

NCBI Gene PubMed Count 132
Grant Count 47
R01 Count 38
Funding $8,168,368.46
PubMed Score 295.18
PubTator Score 228.62

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
Multiple myeloma 1.386 0.000
osteosarcoma -1.087 0.002
group 3 medulloblastoma 1.500 0.000
astrocytoma 1.100 0.007
glioblastoma 1.700 0.001
medulloblastoma, large-cell 1.400 0.000
lung cancer 1.100 0.001
lung adenocarcinoma 1.020 0.000
Pick disease -1.700 0.000
progressive supranuclear palsy -1.200 0.007
ovarian cancer 2.900 0.000

Gene RIF (74)

PMID Text
26797131 NSrp70 acts as a new molecular counterpart for alternative splicing of target RNA, counteracting SRSF1 and SRSF2 splicing activity.
26562302 Data show that tet methylcytosine dioxygenase 2 TET2, isocitrate dehydrogenases 1/2 IDH1/IDH2, serine/arginine-rich splicing factor 2 SRSF2, splicing factor 3b subunit 1 SF3B1, and ras proteins (KRAS/NRAS) are not conserved in dog mast Cell tumors.
26534959 HIV-1-Tat Protein Inhibits SC35-mediated Tau Exon 10 Inclusion through Up-regulation of DYRK1A Kinase.
26406946 We present experimental evidence that splicing factor SRSF1, SRSF2, U2AF35, U2AF65 and KHSRP expression levels in gastrointestinal tract (colon, gastric and pancreatic) tumors differ compare to healthy tissues and in cell lines.
26261309 findings shed light on the mechanism of the disease-associated SRSF2 mutation in splicing regulation and also reveal a group of misspliced mRNA isoforms for potential therapeutic targeting
25964599 The mutational status of the SRSF2, U2AF1 and ZRSR2 did not affect the response rate or survival in MDS patients who had received first-line decitabine treatment.
25889056 The authors propose that splicing at 3'ss A3 is dependent on binding of the enhancing SR proteins SRSF2 and SRSF6 to the HIV-1 tat ESE and ESE2 sequence.
25889056 SRSF2 and SRSF6 cooperatively activate HIV-1 Tat-specific 3'ss A3 site, either through two separate required mechanisms or by stabilizing each other on their respective target sequences
25765854 Our results show that diverse microenvironment cues affect different attributes of the SC-35 organizational metrics and lead to distinct emergent organizational patterns.
25717103 SRSF2 is required for expression of HPV16 E6E7 mRNAs in cervical tumor but not nontumor cells and may act by inhibiting their decay.
More...

AA Sequence

MSYGRPPPDVEGMTSLKVDNLTYRTSPDTLRRVFEKYGRVGDVYIPRDRYTKESRGFAFVRFHDKRDAED      1 - 70
AMDAMDGAVLDGRELRVQMARYGRPPDSHHSRRGPPPRRYGGGGYGRRSRSPRRRRRSRSRSRSRSRSRS     71 - 140
RSRYSRSKSRSRTRSRSRSTSKSRSARRSKSKSSSVSRSRSRSRSRSRSRSPPPVSKRESKSRSRSKSPP    141 - 210
KSPEEEGAVSS                                                               211 - 221
//

Text Mined References (144)

PMID Year Title
26797131 2016 Nuclear Speckle-related Protein 70 Binds to Serine/Arginine-rich Splicing Factors 1 and 2 via an Arginine/Serine-like Region and Counteracts Their Alternative Splicing Activity.
26562302 2015 Mutational Hotspot of TET2, IDH1, IDH2, SRSF2, SF3B1, KRAS, and NRAS from Human Systemic Mastocytosis Are Not Conserved in Canine Mast Cell Tumors.
26534959 2015 HIV-1-Tat Protein Inhibits SC35-mediated Tau Exon 10 Inclusion through Up-regulation of DYRK1A Kinase.
26406946 2015 Gastrointestinal tract tumors and cell lines possess differential splicing factor expression and tumor associated mRNA isoform formation profiles.
26261309 2015 Disease-associated mutation in SRSF2 misregulates splicing by altering RNA-binding affinities.
25964599 2015 Mutations in the Spliceosomal Machinery Genes SRSF2, U2AF1, and ZRSR2 and Response to Decitabine in Myelodysplastic Syndrome.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25889056 2015 Balanced splicing at the Tat-specific HIV-1 3'ss A3 is critical for HIV-1 replication.
25765854 2015 Organizational metrics of interchromatin speckle factor domains: integrative classifier for stem cell adhesion & lineage signaling.
25717103 2015 Human Papillomavirus 16 Oncoprotein Expression Is Controlled by the Cellular Splicing Factor SRSF2 (SC35).
More...