Property Summary

NCBI Gene PubMed Count 148
PubMed Score 317.44
PubTator Score 228.62

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
astrocytoma 1.100 6.7e-03
glioblastoma 1.100 1.7e-02
group 3 medulloblastoma 1.300 1.2e-04
lung adenocarcinoma 1.020 1.5e-07
lung cancer 1.100 7.3e-04
medulloblastoma, large-cell 1.400 2.4e-06
Multiple myeloma 1.235 1.1e-04
osteosarcoma -1.087 2.2e-03
ovarian cancer -1.600 3.4e-07
Pick disease -1.400 3.8e-05
progressive supranuclear palsy -1.200 6.8e-03

 GWAS Trait (1)

Gene RIF (88)

AA Sequence

MSYGRPPPDVEGMTSLKVDNLTYRTSPDTLRRVFEKYGRVGDVYIPRDRYTKESRGFAFVRFHDKRDAED      1 - 70
AMDAMDGAVLDGRELRVQMARYGRPPDSHHSRRGPPPRRYGGGGYGRRSRSPRRRRRSRSRSRSRSRSRS     71 - 140
RSRYSRSKSRSRTRSRSRSTSKSRSARRSKSKSSSVSRSRSRSRSRSRSRSPPPVSKRESKSRSRSKSPP    141 - 210
KSPEEEGAVSS                                                               211 - 221
//

Text Mined References (160)

PMID Year Title