Property Summary

Ligand Count 8
NCBI Gene PubMed Count 14
PubMed Score 8.52
PubTator Score 30.64

Knowledge Summary

Patent (7,907)

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Autistic Disorder 364 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.4
Kidney cancer 2613 0.0 0.8
Liver cancer 604 0.0 0.8
Disease Target Count Z-score Confidence
Amyotrophic lateral sclerosis 451 0.0 0.9

Expression

  Differential Expression (21)

Disease log2 FC p
lung cancer -4.000 4.9e-06
adrenocortical adenoma -2.051 5.3e-03
adrenocortical carcinoma -3.695 4.1e-23
aldosterone-producing adenoma -1.052 3.9e-02
Astrocytoma, Pilocytic 1.200 1.5e-03
Atopic dermatitis -1.400 1.3e-02
atypical teratoid / rhabdoid tumor -1.600 4.4e-06
Breast cancer -3.400 3.8e-02
colon cancer -4.800 9.8e-13
group 4 medulloblastoma -1.400 4.3e-03
intraductal papillary-mucinous adenoma (... -3.300 5.9e-04
intraductal papillary-mucinous carcinoma... -4.200 9.9e-05
intraductal papillary-mucinous neoplasm ... -4.400 1.7e-03
invasive ductal carcinoma -1.500 5.9e-03
lung adenocarcinoma -2.000 1.5e-09
lung carcinoma -2.500 1.9e-10
non-small cell lung cancer -1.419 7.5e-17
oligodendroglioma -1.500 1.6e-02
ovarian cancer -1.600 6.8e-06
pancreatic cancer -1.300 9.8e-03
psoriasis -1.300 1.2e-18

Gene RIF (4)

AA Sequence

MLASPEPKGLVPFTKESFELIKQHIAKTHNEDHEEEDLKPTPDLEVGKKLPFIYGNLSQGMVSEPLEDVD      1 - 70
PYYYKKKNTFIVLNKNRTIFRFNAASILCTLSPFNCIRRTTIKVLVHPFFQLFILISVLIDCVFMSLTNL     71 - 140
PKWRPVLENTLLGIYTFEILVKLFARGVWAGSFSFLGDPWNWLDFSVTVFEVIIRYSPLDFIPTLQTART    141 - 210
LRILKIIPLNQGLKSLVGVLIHCLKQLIGVIILTLFFLSIFSLIGMGLFMGNLKHKCFRWPQENENETLH    211 - 280
NRTGNPYYIRETENFYYLEGERYALLCGNRTDAGQCPEGYVCVKAGINPDQGFTNFDSFGWALFALFRLM    281 - 350
AQDYPEVLYHQILYASGKVYMIFFVVVSFLFSFYMASLFLGILAMAYEEEKQRVGEISKKIEPKFQQTGK    351 - 420
ELQEGNETDEAKTIQIEMKKRSPISTDTSLDVLEDATLRHKEELEKSKKICPLYWYKFAKTFLIWNCSPC    421 - 490
WLKLKEFVHRIIMAPFTDLFLIICIILNVCFLTLEHYPMSKQTNTLLNIGNLVFIGIFTAEMIFKIIAMH    491 - 560
PYGYFQVGWNIFDSMIVFHGLIELCLANVAGMALLRLFRMLRIFKLGKYWPTFQILMWSLSNSWVALKDL    561 - 630
VLLLFTFIFFSAAFGMKLFGKNYEEFVCHIDKDCQLPRWHMHDFFHSFLNVFRILCGEWVETLWDCMEVA    631 - 700
GQSWCIPFYLMVILIGNLLVLYLFLALVSSFSSCKDVTAEENNEAKNLQLAVARIKKGINYVLLKILCKT    701 - 770
QNVPKDTMDHVNEVYVKEDISDHTLSELSNTQDFLKDKEKSSGTEKNATENESQSLIPSPSVSETVPIAS    771 - 840
GESDIENLDNKEIQSKSGDGGSKEKIKQSSSSECSTVDIAISEEEEMFYGGERSKHLKNGCRRGSSLGQI    841 - 910
SGASKKGKIWQNIRKTCCKIVENNWFKCFIGLVTLLSTGTLAFEDIYMDQRKTIKILLEYADMIFTYIFI    911 - 980
LEMLLKWMAYGFKAYFSNGWYRLDFVVVIVFCLSLIGKTREELKPLISMKFLRPLRVLSQFERMKVVVRA    981 - 1050
LIKTTLPTLNVFLVCLMIWLIFSIMGVDLFAGRFYECIDPTSGERFPSSEVMNKSRCESLLFNESMLWEN   1051 - 1120
AKMNFDNVGNGFLSLLQVATFNGWITIMNSAIDSVAVNIQPHFEVNIYMYCYFINFIIFGVFLPLSMLIT   1121 - 1190
VIIDNFNKHKIKLGGSNIFITVKQRKQYRRLKKLMYEDSQRPVPRPLNKLQGFIFDVVTSQAFNVIVMVL   1191 - 1260
ICFQAIAMMIDTDVQSLQMSIALYWINSIFVMLYTMECILKLIAFRCFYFTIAWNIFDFMVVIFSITGLC   1261 - 1330
LPMTVGSYLVPPSLVQLILLSRIIHMLRLGKGPKVFHNLMLPLMLSLPALLNIILLIFLVMFIYAVFGMY   1331 - 1400
NFAYVKKEAGINDVSNFETFGNSMLCLFQVAIFAGWDGMLDAIFNSKWSDCDPDKINPGTQVRGDCGNPS   1401 - 1470
VGIFYFVSYILISWLIIVNMYIVVVMEFLNIASKKKNKTLSEDDFRKFFQVWKRFDPDRTQYIDSSKLSD   1471 - 1540
FAAALDPPLFMAKPNKGQLIALDLPMAVGDRIHCLDILLAFTKRVMGQDVRMEKVVSEIESGFLLANPFK   1541 - 1610
ITCEPITTTLKRKQEAVSATIIQRAYKNYRLRRNDKNTSDIHMIDGDRDVHATKEGAYFDKAKEKSPIQS   1611 - 1680
QI                                                                       1681 - 1682
//

Text Mined References (16)

PMID Year Title