Property Summary

NCBI Gene PubMed Count 14
PubMed Score 6.26
PubTator Score 30.64

Knowledge Summary

Patent (7,907)

TINX Plot

  Disease Sources (4)

Disease Target Count
Autistic Disorder 320
Disease Target Count P-value
non-small cell lung cancer 2798 2.26976270998805E-32
adrenocortical carcinoma 1427 4.10917205618945E-23
lung adenocarcinoma 2714 7.35496218029497E-18
colon cancer 1475 9.78306177059288E-13
psoriasis 6685 7.02318993767624E-12
lung carcinoma 2844 1.87588315709599E-10
pilocytic astrocytoma 3086 3.98040832137559E-8
lung cancer 4473 2.5373960002877E-7
atypical teratoid / rhabdoid tumor 4369 4.41324681703109E-6
ovarian cancer 8492 2.44465898822332E-5
intraductal papillary-mucinous carcinoma (IPMC) 2988 9.87992856887063E-5
intraductal papillary-mucinous adenoma (IPMA) 2956 5.85059816573064E-4
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00168545585860763
group 4 medulloblastoma 1875 0.00432314923324417
adrenocortical adenoma 134 0.00526685614564395
invasive ductal carcinoma 2950 0.00585259307301709
pancreatic cancer 2300 0.00977526417032428
Atopic dermatitis 944 0.0126120611800629
oligodendroglioma 2849 0.0155675737287155
Breast cancer 3099 0.0382297880111965
aldosterone-producing adenoma 664 0.0390502766448141
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0

Expression

  Differential Expression (21)

Synonym

Accession Q01118
Symbols NaG
SCN6A
Nav2.1
Nav2.2

Gene

  Ortholog (7)

Gene RIF (4)

PMID Text
26537257 The authors demonstrated that the sodium channel Nax functions as a sodium sensor. With increased extracellular sodium, Nax up-regulates prostasin, which results in activation of the sodium channel ENaC.
25393565 SNP rs7565062 of SCN7A was significantly associated with essential hypertension in a Northern Han Chinese population
17339538 Observational study of gene-disease association. (HuGE Navigator)
14669210 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MLASPEPKGLVPFTKESFELIKQHIAKTHNEDHEEEDLKPTPDLEVGKKLPFIYGNLSQGMVSEPLEDVD      1 - 70
PYYYKKKNTFIVLNKNRTIFRFNAASILCTLSPFNCIRRTTIKVLVHPFFQLFILISVLIDCVFMSLTNL     71 - 140
PKWRPVLENTLLGIYTFEILVKLFARGVWAGSFSFLGDPWNWLDFSVTVFEVIIRYSPLDFIPTLQTART    141 - 210
LRILKIIPLNQGLKSLVGVLIHCLKQLIGVIILTLFFLSIFSLIGMGLFMGNLKHKCFRWPQENENETLH    211 - 280
NRTGNPYYIRETENFYYLEGERYALLCGNRTDAGQCPEGYVCVKAGINPDQGFTNFDSFGWALFALFRLM    281 - 350
AQDYPEVLYHQILYASGKVYMIFFVVVSFLFSFYMASLFLGILAMAYEEEKQRVGEISKKIEPKFQQTGK    351 - 420
ELQEGNETDEAKTIQIEMKKRSPISTDTSLDVLEDATLRHKEELEKSKKICPLYWYKFAKTFLIWNCSPC    421 - 490
WLKLKEFVHRIIMAPFTDLFLIICIILNVCFLTLEHYPMSKQTNTLLNIGNLVFIGIFTAEMIFKIIAMH    491 - 560
PYGYFQVGWNIFDSMIVFHGLIELCLANVAGMALLRLFRMLRIFKLGKYWPTFQILMWSLSNSWVALKDL    561 - 630
VLLLFTFIFFSAAFGMKLFGKNYEEFVCHIDKDCQLPRWHMHDFFHSFLNVFRILCGEWVETLWDCMEVA    631 - 700
GQSWCIPFYLMVILIGNLLVLYLFLALVSSFSSCKDVTAEENNEAKNLQLAVARIKKGINYVLLKILCKT    701 - 770
QNVPKDTMDHVNEVYVKEDISDHTLSELSNTQDFLKDKEKSSGTEKNATENESQSLIPSPSVSETVPIAS    771 - 840
GESDIENLDNKEIQSKSGDGGSKEKIKQSSSSECSTVDIAISEEEEMFYGGERSKHLKNGCRRGSSLGQI    841 - 910
SGASKKGKIWQNIRKTCCKIVENNWFKCFIGLVTLLSTGTLAFEDIYMDQRKTIKILLEYADMIFTYIFI    911 - 980
LEMLLKWMAYGFKAYFSNGWYRLDFVVVIVFCLSLIGKTREELKPLISMKFLRPLRVLSQFERMKVVVRA    981 - 1050
LIKTTLPTLNVFLVCLMIWLIFSIMGVDLFAGRFYECIDPTSGERFPSSEVMNKSRCESLLFNESMLWEN   1051 - 1120
AKMNFDNVGNGFLSLLQVATFNGWITIMNSAIDSVAVNIQPHFEVNIYMYCYFINFIIFGVFLPLSMLIT   1121 - 1190
VIIDNFNKHKIKLGGSNIFITVKQRKQYRRLKKLMYEDSQRPVPRPLNKLQGFIFDVVTSQAFNVIVMVL   1191 - 1260
ICFQAIAMMIDTDVQSLQMSIALYWINSIFVMLYTMECILKLIAFRCFYFTIAWNIFDFMVVIFSITGLC   1261 - 1330
LPMTVGSYLVPPSLVQLILLSRIIHMLRLGKGPKVFHNLMLPLMLSLPALLNIILLIFLVMFIYAVFGMY   1331 - 1400
NFAYVKKEAGINDVSNFETFGNSMLCLFQVAIFAGWDGMLDAIFNSKWSDCDPDKINPGTQVRGDCGNPS   1401 - 1470
VGIFYFVSYILISWLIIVNMYIVVVMEFLNIASKKKNKTLSEDDFRKFFQVWKRFDPDRTQYIDSSKLSD   1471 - 1540
FAAALDPPLFMAKPNKGQLIALDLPMAVGDRIHCLDILLAFTKRVMGQDVRMEKVVSEIESGFLLANPFK   1541 - 1610
ITCEPITTTLKRKQEAVSATIIQRAYKNYRLRRNDKNTSDIHMIDGDRDVHATKEGAYFDKAKEKSPIQS   1611 - 1680
QI                                                                       1681 - 1682
//

Text Mined References (16)

PMID Year Title
26537257 2015 Sodium channel Nax is a regulator in epithelial sodium homeostasis.
25393565 2015 The association between the polymorphisms in a sodium channel gene SCN7A and essential hypertension: a case-control study in the Northern Han Chinese.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
19451621 2009 Reduced expression of the Kinesin-Associated Protein 3 (KIFAP3) gene increases survival in sporadic amyotrophic lateral sclerosis.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17339538 2007 Genetic variations associated with echocardiographic left ventricular traits in hypertensive blacks.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
14669210 2003 [Association of single nucleotide polymorphism in human SCN7A gene with essential hypertension in Chinese].
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11144347 2000 Nomenclature of voltage-gated sodium channels.
More...