Property Summary

NCBI Gene PubMed Count 46
PubMed Score 5.32
PubTator Score 45.45

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count
Liver diseases 66

Expression

Synonym

Accession Q01113 B9ZVT0 Q14634 Q8WWU1 Q96TF0 IL-9 receptor
Symbols CD129
IL-9R

Gene

  Ortholog (3)

Species Source
Mouse OMA Inparanoid
Rat OMA Inparanoid
Dog OMA EggNOG

Gene RIF (27)

PMID Text
26082242 The findings indicated that IL-9R was constitutively expressed and exerted a tumor-promoting effect in hepatocellular carcinoma, whose expression level may be a useful biomarker of tumor invasiveness and patient clinical outcome.
25421756 Low expression of CD39(+) /CD45RA(+) on regulatory T cells (Treg ) cells in type 1 diabetic children in contrast to high expression of CD101(+) /CD129(+) on Treg cells in children with coeliac disease.
25297818 Confocal microscopy and fluorescence resonance energy transfer experiments revealed nonrandom association of IL-9R with IL-2R/major histocompatibility complex glycoproteins at the surface of human T lymphoma cells.
24908389 Mice with PU.1 deficiency in T cells were protected from colitis, whereas treatment with antibody to IL-9 suppressed colitis
23638223 Our findings suggest that overexpression of IL-9R may contribute to the pathogenesis of diffuse large B-cell lymphoma
22638550 One of the identified peptide sequences corresponded to a fragment of the human interleukin-9 receptor alpha (IL-9Ralpha).
21371865 analysis of IL-9 and IL-9 receptor gene polymorphisms and atopic dermatitis in a Korean population
20673868 Observational study of gene-disease association. (HuGE Navigator)
20595916 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20503287 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MGLGRCIWEGWTLESEALRRDMGTWLLACICICTCVCLGVSVTGEGQGPRSRTFTCLTNNILRIDCHWSA      1 - 70
PELGQGSSPWLLFTSNQAPGGTHKCILRGSECTVVLPPEAVLVPSDNFTITFHHCMSGREQVSLVDPEYL     71 - 140
PRRHVKLDPPSDLQSNISSGHCILTWSISPALEPMTTLLSYELAFKKQEEAWEQAQHRDHIVGVTWLILE    141 - 210
AFELDPGFIHEARLRVQMATLEDDVVEEERYTGQWSEWSQPVCFQAPQRQGPLIPPWGWPGNTLVAVSIF    211 - 280
LLLTGPTYLLFKLSPRVKRIFYQNVPSPAMFFQPLYSVHNGNFQTWMGAHGAGVLLSQDCAGTPQGALEP    281 - 350
CVQEATALLTCGPARPWKSVALEEEQEGPGTRLPGNLSSEDVLPAGCTEWRVQTLAYLPQEDWAPTSLTR    351 - 420
PAPPDSEGSRSSSSSSSSNNNNYCALGCYGGWHLSALPGNTQSSGPIPALACGLSCDHQGLETQQGVAWV    421 - 490
LAGHCQRPGLHEDLQGMLLPSVLSKARSWTF                                           491 - 521
//

Text Mined References (47)

PMID Year Title
26082242 2015 High expression of IL-9R promotes the progression of human hepatocellular carcinoma and indicates a poor clinical outcome.
25421756 2015 Low expression of CD39(+) /CD45RA(+) on regulatory T cells (Treg ) cells in type 1 diabetic children in contrast to high expression of CD101(+) /CD129(+) on Treg cells in children with coeliac disease.
25297818 2014 Distinct spatial relationship of the interleukin-9 receptor with interleukin-2 receptor and major histocompatibility complex glycoproteins in human T lymphoma cells.
24908389 2014 TH9 cells that express the transcription factor PU.1 drive T cell-mediated colitis via IL-9 receptor signaling in intestinal epithelial cells.
24270810 2013 High-content genome-wide RNAi screens identify regulators of parkin upstream of mitophagy.
23638223 2013 Overexpression of IL-9 receptor in diffuse large B-cell lymphoma.
22638550 2012 A naturally processed HLA-DR-bound peptide from the IL-9 receptor alpha of HTLV-1-transformed T cells serves as a T helper epitope.
21371865 2011 An association between IL-9 and IL-9 receptor gene polymorphisms and atopic dermatitis in a Korean population.
20673868 2010 A genetic association study of maternal and fetal candidate genes that predispose to preterm prelabor rupture of membranes (PROM).
20595916 2010 Association between IL-1A single nucleotide polymorphisms and chronic beryllium disease and beryllium sensitization.
More...