Property Summary

NCBI Gene PubMed Count 49
PubMed Score 6.29
PubTator Score 45.45

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Brain Injuries 65 0.0 0.0
Liver diseases 87 0.0 0.0
Disease Target Count
Mood Disorders 184
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5

Expression

Protein-protein Interaction (10)

Gene RIF (30)

AA Sequence

MGLGRCIWEGWTLESEALRRDMGTWLLACICICTCVCLGVSVTGEGQGPRSRTFTCLTNNILRIDCHWSA      1 - 70
PELGQGSSPWLLFTSNQAPGGTHKCILRGSECTVVLPPEAVLVPSDNFTITFHHCMSGREQVSLVDPEYL     71 - 140
PRRHVKLDPPSDLQSNISSGHCILTWSISPALEPMTTLLSYELAFKKQEEAWEQAQHRDHIVGVTWLILE    141 - 210
AFELDPGFIHEARLRVQMATLEDDVVEEERYTGQWSEWSQPVCFQAPQRQGPLIPPWGWPGNTLVAVSIF    211 - 280
LLLTGPTYLLFKLSPRVKRIFYQNVPSPAMFFQPLYSVHNGNFQTWMGAHGAGVLLSQDCAGTPQGALEP    281 - 350
CVQEATALLTCGPARPWKSVALEEEQEGPGTRLPGNLSSEDVLPAGCTEWRVQTLAYLPQEDWAPTSLTR    351 - 420
PAPPDSEGSRSSSSSSSSNNNNYCALGCYGGWHLSALPGNTQSSGPIPALACGLSCDHQGLETQQGVAWV    421 - 490
LAGHCQRPGLHEDLQGMLLPSVLSKARSWTF                                           491 - 521
//

Text Mined References (50)

PMID Year Title