Property Summary

NCBI Gene PubMed Count 46
Grant Count 12
R01 Count 10
Funding $988,966.92
PubMed Score 5.32
PubTator Score 45.45

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Liver diseases 66

Expression

Gene RIF (27)

PMID Text
26082242 The findings indicated that IL-9R was constitutively expressed and exerted a tumor-promoting effect in hepatocellular carcinoma, whose expression level may be a useful biomarker of tumor invasiveness and patient clinical outcome.
25421756 Low expression of CD39(+) /CD45RA(+) on regulatory T cells (Treg ) cells in type 1 diabetic children in contrast to high expression of CD101(+) /CD129(+) on Treg cells in children with coeliac disease.
25297818 Confocal microscopy and fluorescence resonance energy transfer experiments revealed nonrandom association of IL-9R with IL-2R/major histocompatibility complex glycoproteins at the surface of human T lymphoma cells.
24908389 Mice with PU.1 deficiency in T cells were protected from colitis, whereas treatment with antibody to IL-9 suppressed colitis
23638223 Our findings suggest that overexpression of IL-9R may contribute to the pathogenesis of diffuse large B-cell lymphoma
22638550 One of the identified peptide sequences corresponded to a fragment of the human interleukin-9 receptor alpha (IL-9Ralpha).
21371865 analysis of IL-9 and IL-9 receptor gene polymorphisms and atopic dermatitis in a Korean population
20673868 Observational study of gene-disease association. (HuGE Navigator)
20595916 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20503287 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MGLGRCIWEGWTLESEALRRDMGTWLLACICICTCVCLGVSVTGEGQGPRSRTFTCLTNNILRIDCHWSA      1 - 70
PELGQGSSPWLLFTSNQAPGGTHKCILRGSECTVVLPPEAVLVPSDNFTITFHHCMSGREQVSLVDPEYL     71 - 140
PRRHVKLDPPSDLQSNISSGHCILTWSISPALEPMTTLLSYELAFKKQEEAWEQAQHRDHIVGVTWLILE    141 - 210
AFELDPGFIHEARLRVQMATLEDDVVEEERYTGQWSEWSQPVCFQAPQRQGPLIPPWGWPGNTLVAVSIF    211 - 280
LLLTGPTYLLFKLSPRVKRIFYQNVPSPAMFFQPLYSVHNGNFQTWMGAHGAGVLLSQDCAGTPQGALEP    281 - 350
CVQEATALLTCGPARPWKSVALEEEQEGPGTRLPGNLSSEDVLPAGCTEWRVQTLAYLPQEDWAPTSLTR    351 - 420
PAPPDSEGSRSSSSSSSSNNNNYCALGCYGGWHLSALPGNTQSSGPIPALACGLSCDHQGLETQQGVAWV    421 - 490
LAGHCQRPGLHEDLQGMLLPSVLSKARSWTF                                           491 - 521
//

Text Mined References (47)

PMID Year Title
26082242 2015 High expression of IL-9R promotes the progression of human hepatocellular carcinoma and indicates a poor clinical outcome.
25421756 2015 Low expression of CD39(+) /CD45RA(+) on regulatory T cells (Treg ) cells in type 1 diabetic children in contrast to high expression of CD101(+) /CD129(+) on Treg cells in children with coeliac disease.
25297818 2014 Distinct spatial relationship of the interleukin-9 receptor with interleukin-2 receptor and major histocompatibility complex glycoproteins in human T lymphoma cells.
24908389 2014 TH9 cells that express the transcription factor PU.1 drive T cell-mediated colitis via IL-9 receptor signaling in intestinal epithelial cells.
24270810 2013 High-content genome-wide RNAi screens identify regulators of parkin upstream of mitophagy.
23638223 2013 Overexpression of IL-9 receptor in diffuse large B-cell lymphoma.
22638550 2012 A naturally processed HLA-DR-bound peptide from the IL-9 receptor alpha of HTLV-1-transformed T cells serves as a T helper epitope.
21371865 2011 An association between IL-9 and IL-9 receptor gene polymorphisms and atopic dermatitis in a Korean population.
20673868 2010 A genetic association study of maternal and fetal candidate genes that predispose to preterm prelabor rupture of membranes (PROM).
20595916 2010 Association between IL-1A single nucleotide polymorphisms and chronic beryllium disease and beryllium sensitization.
More...