Property Summary

NCBI Gene PubMed Count 136
PubMed Score 358.64
PubTator Score 80.71

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Necrosis 53 0.0 0.0
Neoplasm Invasiveness 161 0.0 0.0
Disease Target Count P-value
Multiple myeloma 1332 8.8e-06
ovarian cancer 8520 4.1e-04
lung cancer 4740 4.7e-04
group 3 medulloblastoma 4104 8.0e-04
dermatomyositis 966 1.3e-03
Waldenstrons macroglobulinemia 765 1.3e-03
Disease Target Count Z-score Confidence
Cancer 2499 3.116 1.6

Expression

  Differential Expression (6)

Disease log2 FC p
dermatomyositis 1.100 1.3e-03
group 3 medulloblastoma 1.300 8.0e-04
lung cancer 1.800 4.7e-04
Multiple myeloma 2.010 8.8e-06
ovarian cancer -1.600 4.1e-04
Waldenstrons macroglobulinemia 1.562 1.3e-03

Gene RIF (94)

AA Sequence

MAPKRQSPLPPQKKKPRPPPALGPEETSASAGLPKKGEKEQQEAIEHIDEVQNEIDRLNEQASEEILKVE      1 - 70
QKYNKLRQPFFQKRSELIAKIPNFWVTTFVNHPQVSALLGEEDEEALHYLTRVEVTEFEDIKSGYRIDFY     71 - 140
FDENPYFENKVLSKEFHLNESGDPSSKSTEIKWKSGKDLTKRSSQTQNKASRKRQHEEPESFFTWFTDHS    141 - 210
DAGADELGEVIKDDIWPNPLQYYLVPDMDDEEGEGEEDDDDDEEEEGLEDIDEEGDEDEGEEDEDDDEGE    211 - 280
EGEEDEGEDD                                                                281 - 290
//

Text Mined References (150)

PMID Year Title