Property Summary

NCBI Gene PubMed Count 125
Grant Count 85
R01 Count 59
Funding $10,873,675.89
PubMed Score 335.81
PubTator Score 80.71

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.562 0.001
Multiple myeloma 2.561 0.000
lung cancer 1.900 0.025
group 3 medulloblastoma 1.300 0.001
ovarian cancer -1.600 0.000
dermatomyositis 1.100 0.001

Synonym

Accession Q01105 A5A5H4 A6NGV1 B4DUE2 Q15541 Q5VXV1 Q5VXV2 Q6FHZ5
Symbols 2PP2A
IGAAD
TAF-I
I2PP2A
IPP2A2
PHAPII
TAF-IBETA

Gene

SET

PDB

2E50  

Gene RIF (83)

PMID Text
26575017 Data show that downregulating proto-oncogene protein Akt (p-Akt) by inhibiting PP2A inhibitor SET-mediated protein phosphatase 2A (PP2A) inactivation determined the pro-apoptotic effects of EMQA and paclitaxel combination treatment.
26563471 Data suggest a critical role for the I2PP2A protein (SET)-protein phosphatase-2A (PP2A) signaling axis in Pten protein (Pten) deficient castration resistant prostate cancer (CRPC) progression.
26234767 Alterations affecting PP2A subunits together with the deregulation of endogenous PP2A inhibitors such as CIP2A and SET have been described as contributing mechanisms to inactivate PP2A in prostate cancer.
26216969 These findings establish a framework for understanding the molecular basis of cytochrome c-mediated blocking of SET/TAF-Ibeta.
26115722 Low SET expression is associated with bone metastasis in renal cell carcinoma.
25945834 Data show that the biogical effect of inhibitor-2 of protein phosphatase-2A (SET) on proliferation and invasion was mediated by the inhibition of the protein phosphatase 2A (PP2A).
25818296 SET interacts with the Kruppel-associated box (KRAB)-associated co-repressor KAP1, and its overexpression results in the sustained retention of KAP1 and Heterochromatin protein 1 (HP1) on chromatin
25760096 the results of the present study demonstrated that SET was associated with paclitaxel resistance in MCF-7/PTX cells, and that paeonol reversed paclitaxel resistance in MCF-7/PTX cells by downregulating the activity of the SET/PP2A/Akt pathway.
25656576 Therefore, SET overexpression in HEK293 cells promotes mitochondrial fission and reduces autophagic flux in apparent association with up-regulation of UCP2 and UCP3.
25388166 SET overexpression is a frequent event in metastatic colorectal cancer that plays a potential oncogenic role associated with worse outcome and resistance to oxaliplatin.
More...

AA Sequence

MAPKRQSPLPPQKKKPRPPPALGPEETSASAGLPKKGEKEQQEAIEHIDEVQNEIDRLNEQASEEILKVE      1 - 70
QKYNKLRQPFFQKRSELIAKIPNFWVTTFVNHPQVSALLGEEDEEALHYLTRVEVTEFEDIKSGYRIDFY     71 - 140
FDENPYFENKVLSKEFHLNESGDPSSKSTEIKWKSGKDLTKRSSQTQNKASRKRQHEEPESFFTWFTDHS    141 - 210
DAGADELGEVIKDDIWPNPLQYYLVPDMDDEEGEGEEDDDDDEEEEGLEDIDEEGDEDEGEEDEDDDEGE    211 - 280
EGEEDEGEDD                                                                281 - 290
//

Text Mined References (138)

PMID Year Title
26575017 2016 SET antagonist enhances the chemosensitivity of non-small cell lung cancer cells by reactivating protein phosphatase 2A.
26563471 2015 Inhibition of Pten deficient Castration Resistant Prostate Cancer by Targeting of the SET - PP2A Signaling axis.
26234767 2015 PP2A inhibition as a novel therapeutic target in castration-resistant prostate cancer.
26216969 2015 Structural basis for inhibition of the histone chaperone activity of SET/TAF-I? by cytochrome c.
26115722 2015 Eight proteins play critical roles in RCC with bone metastasis via mitochondrial dysfunction.
25945834 2015 Overexpression of PP2A inhibitor SET oncoprotein is associated with tumor progression and poor prognosis in human non-small cell lung cancer.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25818296 2015 The nuclear oncogene SET controls DNA repair by KAP1 and HP1 retention to chromatin.
25760096 2015 Paclitaxel resistance in MCF-7/PTX cells is reversed by paeonol through suppression of the SET/phosphatidylinositol 3-kinase/Akt pathway.
25656576 2015 SET overexpression in HEK293 cells regulates mitochondrial uncoupling proteins levels within a mitochondrial fission/reduced autophagic flux scenario.
More...