Property Summary

NCBI Gene PubMed Count 22
Grant Count 35
R01 Count 20
Funding $2,720,890.15
PubMed Score 342.30
PubTator Score 190.48

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
oligodendroglioma 1.700 0.034
posterior fossa group B ependymoma -2.200 0.001
group 4 medulloblastoma 4.700 0.000
medulloblastoma, large-cell 3.900 0.000
lung cancer 1.800 0.000
colon cancer -1.300 0.000
pilocytic astrocytoma -2.500 0.000
aldosterone-producing adenoma -2.085 0.015
nasopharyngeal carcinoma 1.600 0.025

Gene RIF (17)

PMID Text
27072116 Small cell lung cancer tissues were strongly positive for INSM1. INSM1 signal was not detected on normal adjacent tissues from lung cancer patients or normal lung tissues
26530405 the INSM1-promoter specific conditional replicating adenovirus represents a sensitive diagnostic tool to aid clinicians in the detection of NE tumors.
26482608 Insulinoma-Associated Protein 1 is a crucial regulator of neuroendocrine differentiation in lung cancer.
26386079 INSM1 expression was significantly increased in Neuroendocrine neoplastic vs nonneoplastic tissue.
25523979 INSM1 autoantibodies were associated with risk of developing type 1 diabetes.
23383108 A synthetic peptide corresponding to the immunosuppressive domain (amino acids 574-592) of HIV-1 gp41 upregulates the expression of insulinoma-associated 1 (INSM1) in peptide-treated PBMCs
21830214 Both the AR42J cell line and the primary cultured mouse acinar cells support role for INSM1 in pancreatic acinar cell trans-differentiation model.
21609490 The results suggest that INSM1 up-regulation plays a positive role in HSV-1 replication, probably by binding to the ICP0 promoter.
20215568 Data show that the consistent functional effect of INSM1, either with or without other ITFs, promotes pancreatic duct cell differentiation as well as induces Panc-1 cell cycle arrest.
19604042 The INSM1 promoter can direct herpes simplex virus thymidine kinase gene expression in a nude mouse model of neuroendocrine cancer and effectively repress tumor growth in response to ganciclovir treatment.
More...

AA Sequence

MPRGFLVKRSKKSTPVSYRVRGGEDGDRALLLSPSCGGARAEPPAPSPVPGPLPPPPPAERAHAALAAAL      1 - 70
ACAPGPQPPPQGPRAAHFGNPEAAHPAPLYSPTRPVSREHEKHKYFERSFNLGSPVSAESFPTPAALLGG     71 - 140
GGGGGASGAGGGGTCGGDPLLFAPAELKMGTAFSAGAEAARGPGPGPPLPPAAALRPPGKRPPPPTAAEP    141 - 210
PAKAVKAPGAKKPKAIRKLHFEDEVTTSPVLGLKIKEGPVEAPRGRAGGAARPLGEFICQLCKEEYADPF    211 - 280
ALAQHKCSRIVRVEYRCPECAKVFSCPANLASHRRWHKPRPAPAAARAPEPEAAARAEAREAPGGGSDRD    281 - 350
TPSPGGVSESGSEDGLYECHHCAKKFRRQAYLRKHLLAHHQALQAKGAPLAPPAEDLLALYPGPDEKAPQ    351 - 420
EAAGDGEGAGVLGLSASAECHLCPVCGESFASKGAQERHLRLLHAAQVFPCKYCPATFYSSPGLTRHINK    421 - 490
CHPSENRQVILLQVPVRPAC                                                      491 - 510
//

Text Mined References (22)

PMID Year Title
27072116 2016 Ectopic expression of a small cell lung cancer transcription factor, INSM1 impairs alveologenesis in lung development.
26530405 2016 Detection of neuroendocrine tumors using promoter-specific secreted Gaussia luciferase.
26482608 2015 Insulinoma-Associated Protein 1 Is a Crucial Regulator of Neuroendocrine Differentiation in Lung Cancer.
26386079 2015 INSM1: A Novel Immunohistochemical and Molecular Marker for Neuroendocrine and Neuroepithelial Neoplasms.
25523979 2015 Autoantibody-defined risk for Type 1 diabetes mellitus in a general population of schoolchildren: results of the Karlsburg Type 1 Diabetes Risk Study after 18 years.
21830214 2012 Functional role of an islet transcription factor, INSM1/IA-1, on pancreatic acinar cell trans-differentiation.
21609490 2011 Herpes simplex virus induces the marked up-regulation of the zinc finger transcriptional factor INSM1, which modulates the expression and localization of the immediate early protein ICP0.
20215568 2010 Insulinoma-associated antigen-1 zinc-finger transcription factor promotes pancreatic duct cell trans-differentiation.
19604042 2009 INSM1 promoter-driven adenoviral herpes simplex virus thymidine kinase cancer gene therapy for the treatment of primitive neuroectodermal tumors.
19246490 2009 Structure, expression, and biological function of INSM1 transcription factor in neuroendocrine differentiation.
More...