Property Summary

NCBI Gene PubMed Count 27
PubMed Score 362.41
PubTator Score 190.48

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
aldosterone-producing adenoma -2.085 1.5e-02
Astrocytoma, Pilocytic -2.600 1.3e-04
colon cancer -1.300 2.3e-05
ependymoma -1.800 4.2e-03
group 3 medulloblastoma 3.900 2.9e-04
lung cancer 1.400 2.8e-02
medulloblastoma, large-cell 3.900 2.0e-04
nasopharyngeal carcinoma 1.600 2.5e-02
oligodendroglioma 1.700 3.4e-02

Gene RIF (22)

AA Sequence

MPRGFLVKRSKKSTPVSYRVRGGEDGDRALLLSPSCGGARAEPPAPSPVPGPLPPPPPAERAHAALAAAL      1 - 70
ACAPGPQPPPQGPRAAHFGNPEAAHPAPLYSPTRPVSREHEKHKYFERSFNLGSPVSAESFPTPAALLGG     71 - 140
GGGGGASGAGGGGTCGGDPLLFAPAELKMGTAFSAGAEAARGPGPGPPLPPAAALRPPGKRPPPPTAAEP    141 - 210
PAKAVKAPGAKKPKAIRKLHFEDEVTTSPVLGLKIKEGPVEAPRGRAGGAARPLGEFICQLCKEEYADPF    211 - 280
ALAQHKCSRIVRVEYRCPECAKVFSCPANLASHRRWHKPRPAPAAARAPEPEAAARAEAREAPGGGSDRD    281 - 350
TPSPGGVSESGSEDGLYECHHCAKKFRRQAYLRKHLLAHHQALQAKGAPLAPPAEDLLALYPGPDEKAPQ    351 - 420
EAAGDGEGAGVLGLSASAECHLCPVCGESFASKGAQERHLRLLHAAQVFPCKYCPATFYSSPGLTRHINK    421 - 490
CHPSENRQVILLQVPVRPAC                                                      491 - 510
//

Text Mined References (27)

PMID Year Title