Property Summary

NCBI Gene PubMed Count 604
PubMed Score 201.43
PubTator Score 969.10

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Expression

  Differential Expression (5)

Disease log2 FC p
Breast cancer 1.100 5.3e-08
glioblastoma 1.100 1.1e-03
malignant mesothelioma 2.100 3.8e-07
medulloblastoma, large-cell 1.600 5.2e-05
ovarian cancer 1.100 7.5e-09

Protein-protein Interaction (2)

Gene RIF (504)

AA Sequence

MALAGAPAGGPCAPALEALLGAGALRLLDSSQIVIISAAQDASAPPAPTGPAAPAAGPCDPDLLLFATPQ      1 - 70
APRPTPSAPRPALGRPPVKRRLDLETDHQYLAESSGPARGRGRHPGKGVKSPGEKSRYETSLNLTTKRFL     71 - 140
ELLSHSADGVVDLNWAAEVLKVQKRRIYDITNVLEGIQLIAKKSKNHIQWLGSHTTVGVGGRLEGLTQDL    141 - 210
RQLQESEQQLDHLMNICTTQLRLLSEDTDSQRLAYVTCQDLRSIADPAEQMVMVIKAPPETQLQAVDSSE    211 - 280
NFQISLKSKQGPIDVFLCPEETVGGISPGKTPSQEVTSEEENRATDSATIVSPPPSSPPSSLTTDPSQSL    281 - 350
LSLEQEPLLSRMGSLRAPVDEDRLSPLVAADSLLEHVREDFSGLLPEEFISLSPPHEALDYHFGLEEGEG    351 - 420
IRDLFDCDFGDLTPLDF                                                         421 - 437
//

Text Mined References (608)

PMID Year Title