Property Summary

NCBI Gene PubMed Count 548
Grant Count 622
R01 Count 456
Funding $42,971,235.84
PubMed Score 187.22
PubTator Score 969.10

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
malignant mesothelioma 2.100 0.000
glioblastoma 1.100 0.001
medulloblastoma, large-cell 1.600 0.000
inflammatory breast cancer 1.700 0.000
ovarian cancer 1.100 0.000

Synonym

Accession Q01094 Q13143 Q92768 E2F-1
Symbols RBP3
E2F-1
RBAP1
RBBP3

Gene

PANTHER Protein Class (1)

PDB

1H24   2AZE   1O9K  

Gene RIF (456)

PMID Text
26989780 transcription-based mechanism that mediates the inflammatory effect of PAD4 and establishes the interplay between citrullination and acetylation in the control of E2F-1 as a regulatory interface for driving inflammatory gene expression
26928463 AR activity was inversely associated with cell proliferation, whereas the expression of Fa complex genes was correlated with elevated cell cycle progression, expression of the E2F transcription factor 1 (E2F1) and loss of RB1.
26921499 We suggest that MNNG-stimulated ATR/CHK1 signaling stabilizes E2F3 by S124 phosphorylation, and then E2F3 together with NFY co-transactivate RRM2 expression for DNA repair.
26833126 HER2 signaling promotes breast cancer cell proliferation through regulation of E2F1-driven DNA metabolism.
26718407 These data suggest that CBX8 modulates SIPS through the RB-E2F1 pathway in CML cells and provide important insight into its application in CML treatment.
26704889 results suggested the existence of E2F1-miR-34c-SCF negative feedback loop which was interrupted by the hyper-methylation of miR-34c promoter in CRC cells and increased cell proliferation.
26659825 Results uncovered the collaboration between EZH2 and E2F1 in controlling downstream genes that are highly expressed in aggressive tumors.
26642705 overexpression of ectopic E2F-1 protein may render cells more sensitive to gemcitabine-mediated apoptosis
26637399 E2F1 expression induced human colon cancer cell death, and suppression of GCN5 expression in cells with E2F1 overexpression further facilitated cell apoptosis
26619117 demonstrate that E2F1 regulates lipid synthesis and glycolysis and thus contributes to the development of liver pathology
More...

AA Sequence

MALAGAPAGGPCAPALEALLGAGALRLLDSSQIVIISAAQDASAPPAPTGPAAPAAGPCDPDLLLFATPQ      1 - 70
APRPTPSAPRPALGRPPVKRRLDLETDHQYLAESSGPARGRGRHPGKGVKSPGEKSRYETSLNLTTKRFL     71 - 140
ELLSHSADGVVDLNWAAEVLKVQKRRIYDITNVLEGIQLIAKKSKNHIQWLGSHTTVGVGGRLEGLTQDL    141 - 210
RQLQESEQQLDHLMNICTTQLRLLSEDTDSQRLAYVTCQDLRSIADPAEQMVMVIKAPPETQLQAVDSSE    211 - 280
NFQISLKSKQGPIDVFLCPEETVGGISPGKTPSQEVTSEEENRATDSATIVSPPPSSPPSSLTTDPSQSL    281 - 350
LSLEQEPLLSRMGSLRAPVDEDRLSPLVAADSLLEHVREDFSGLLPEEFISLSPPHEALDYHFGLEEGEG    351 - 420
IRDLFDCDFGDLTPLDF                                                         421 - 437
//

Text Mined References (552)

PMID Year Title
26989780 2016 Citrullination-acetylation interplay guides E2F-1 activity during the inflammatory response.
26928463 2016 Substantial interindividual and limited intraindividual genomic diversity among tumors from men with metastatic prostate cancer.
26921499 2016 ATR-CHK1-E2F3 signaling transactivates human ribonucleotide reductase small subunit M2 for DNA repair induced by the chemical carcinogen MNNG.
26833126 2016 HER2 Signaling Drives DNA Anabolism and Proliferation through SRC-3 Phosphorylation and E2F1-Regulated Genes.
26718407 2016 CBX8 antagonizes the effect of Sirtinol on premature senescence through the AKT-RB-E2F1 pathway in K562 leukemia cells.
26704889 2015 Interrupted E2F1-miR-34c-SCF negative feedback loop by hyper-methylation promotes colorectal cancer cell proliferation.
26659825 2016 Integrative Analysis Reveals the Transcriptional Collaboration between EZH2 and E2F1 in the Regulation of Cancer-Related Gene Expression.
26642705 2015 Adenovirus-Mediated E2F-1 Gene Transfer Augments Gemcitabine-Induced Apoptosis in Human Colon Cancer Cells.
26637399 2015 The Histone Acetyltransferase GCN5 Expression Is Elevated and Regulated by c-Myc and E2F1 Transcription Factors in Human Colon Cancer.
26619117 2016 E2F1 mediates sustained lipogenesis and contributes to hepatic steatosis.
More...