Property Summary

NCBI Gene PubMed Count 46
Grant Count 64
R01 Count 40
Funding $4,986,380.98
PubMed Score 87.73
PubTator Score 65.90

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
glioblastoma -1.200 0.000
adult high grade glioma -1.200 0.001
invasive ductal carcinoma -1.200 0.000
ovarian cancer -1.900 0.000

Synonym

Accession Q01085 A8K3T0 A8K4L9
Symbols TCBP
TIAR

Gene

PDB

1X4G   2CQI   2DH7  

Gene RIF (27)

PMID Text
26363455 results suggest that TIA-1 and TIAR are two new host factors that interact with 5-UTR of EV71 genome and positively regulate viral replication
25229650 HIV-1 Gag co-localizes and interacts with G3BP1 and TIAR to modulate stress granule assembly during HIV-1 infection
24927121 A role for TIAR is identified in T-cells for control of translational specificity.
24766723 TIA proteins can function as long-term regulators of the ACTB mRNA metabolism in mouse and human cells.
24566137 TIAL1 inhibition of the exon 8 exclusion led to a decrease in SIRT1-Exon8 mRNA levels.
23603827 findings demonstrate that TIAR recognition motif 2 (RRM2), together with its C-terminal extension, is the major contributor for the high-affinity (nM) interactions of TIAR with target RNA sequences
21189287 TIA1 and TIAR proteins are intron-associated positive regulators of SMN2 exon 7 splicing.
21048981 Data show that TIA1 and TIAL1 bind at the same positions on human RNAs, and are consistent with a model where TIA proteins shorten the time available for definition of an alternative exon by enhancing recognition of the preceding 5' splice site.
20980400 Severe hypoxia caused co-aggregation of TIAR/TIA-1 and these proteins suppressed HIF-1alpha expression.
20675271 Data show that apoptotic (TIAR and TIA-1) marker expression in thyroid tissues from adolescents with immune thyroid diseases is higher than in non-immune thyroid diseases.
More...

AA Sequence

MMEDDGQPRTLYVGNLSRDVTEVLILQLFSQIGPCKSCKMITEHTSNDPYCFVEFYEHRDAAAALAAMNG      1 - 70
RKILGKEVKVNWATTPSSQKKDTSNHFHVFVGDLSPEITTEDIKSAFAPFGKISDARVVKDMATGKSKGY     71 - 140
GFVSFYNKLDAENAIVHMGGQWLGGRQIRTNWATRKPPAPKSTQENNTKQLRFEDVVNQSSPKNCTVYCG    141 - 210
GIASGLTDQLMRQTFSPFGQIMEIRVFPEKGYSFVRFSTHESAAHAIVSVNGTTIEGHVVKCYWGKESPD    211 - 280
MTKNFQQVDYSQWGQWSQVYGNPQQYGQYMANGWQVPPYGVYGQPWNQQGFGVDQSPSAAWMGGFGAQPP    281 - 350
QGQAPPPVIPPPNQAGYGMASYQTQ                                                 351 - 375
//

Text Mined References (51)

PMID Year Title
26363455 2015 TIA-1 and TIAR interact with 5'-UTR of enterovirus 71 genome and facilitate viral replication.
24927121 2014 Genome-wide profiling reveals a role for T-cell intracellular antigens TIA1 and TIAR in the control of translational specificity in HeLa cells.
24766723 2014 Long-term reduction of T-cell intracellular antigens leads to increased beta-actin expression.
24566137 2014 HuR and TIA1/TIAL1 are involved in regulation of alternative splicing of SIRT1 pre-mRNA.
23603827 2013 Distinct binding properties of TIAR RRMs and linker region.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
21269460 2011 Initial characterization of the human central proteome.
21189287 2011 TIA1 prevents skipping of a critical exon associated with spinal muscular atrophy.
More...