Property Summary

NCBI Gene PubMed Count 46
PubMed Score 87.73
PubTator Score 65.90

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (4)

Disease log2 FC p
glioblastoma -1.200 2.6e-04
adult high grade glioma -1.200 1.0e-03
invasive ductal carcinoma -1.200 3.3e-04
ovarian cancer -1.900 2.1e-09

Protein-protein Interaction (8)

Gene RIF (27)

PMID Text
26363455 results suggest that TIA-1 and TIAR are two new host factors that interact with 5-UTR of EV71 genome and positively regulate viral replication
25229650 HIV-1 Gag co-localizes and interacts with G3BP1 and TIAR to modulate stress granule assembly during HIV-1 infection
24927121 A role for TIAR is identified in T-cells for control of translational specificity.
24766723 TIA proteins can function as long-term regulators of the ACTB mRNA metabolism in mouse and human cells.
24566137 TIAL1 inhibition of the exon 8 exclusion led to a decrease in SIRT1-Exon8 mRNA levels.
23603827 findings demonstrate that TIAR recognition motif 2 (RRM2), together with its C-terminal extension, is the major contributor for the high-affinity (nM) interactions of TIAR with target RNA sequences
21189287 TIA1 and TIAR proteins are intron-associated positive regulators of SMN2 exon 7 splicing.
21048981 Data show that TIA1 and TIAL1 bind at the same positions on human RNAs, and are consistent with a model where TIA proteins shorten the time available for definition of an alternative exon by enhancing recognition of the preceding 5' splice site.
20980400 Severe hypoxia caused co-aggregation of TIAR/TIA-1 and these proteins suppressed HIF-1alpha expression.
20675271 Data show that apoptotic (TIAR and TIA-1) marker expression in thyroid tissues from adolescents with immune thyroid diseases is higher than in non-immune thyroid diseases.
19805546 SOD1 sequesters Hu antigen R (HuR) and TIA-1-related protein (TIAR) and has a role in impaired post-transcriptional regulation of vascular endothelial growth factor
19110540 TIA1 and TIAL1 regulate the alternate splicing of lysyl hydroxylase 2
18456862 Simultaneous knockdown of TIA1 and TIAL1 resulted in increased skipping of alternatively spliced exons associated with U-rich motifs, but did not affect alternatively spliced exons that are not associated with U-rich motifs.
18201561 In contrast with previous assumptions, the mutated residues are buried within the hydrophobic interior of the domain, where they would be likely to destabilize the RRM fold rather than directly inhibit RNA binding.
17869012 Show increased TIA-1 positive cytotoxic T-lymphocytes in inflamed mucosa of patients with inflammatory bowel disease.
17682065 Results report the identification of a C-rich signature motif present in TIAR target mRNAs whose association with TIAR decreases following exposure to a stress-causing agent.
17512901 Our in vivo data, taken together with previous in vitro results, show that K-SAM splicing activation involves cooperative binding of TIA-1 and U1 snRNP to the exon's 5' splice site region.
17488725 TIAR regulates the relative expression of TIA-1 isoforms.
17486099 Competitive binding of AUF1 and TIAR to MYC mRNA controls its translation.
16890199 adenosine/uridine (AU)-rich element-binding proteins TIA-1 (T-cell intracellular antigen-1), TIAR (TIA-1-related protein), and HuR (Hu antigen R) interact with the beta-F1-ATPase mRNA through an AU-rich sequence located to the 3'-UTR.
16581801 TIAL1 maintains cytochrome c biosynthesis.
16537914 TIAR-mediated inhibition of translation factor expression elicits a sustained repression of protein biosynthesis in cells responding to stress.
16243297 Furthermore, we found that overexpression of DISC1 in SH-SY5Y cells induces the assembly of eIF3- and TIA-1-positive stress granules (SGs), discrete cytoplasmic granules formed in response to environmental stresses.
16191398 TIAR seems to be involved in the post-transcriptional regulation of human iNOS expression
15514971 HuR, KSRP and TIAR are bound to one or more loci in the 3'UTR of IL-8 in breast cancer cells.
15280467 activated during HSV-1 infection and accumulated in cytoplasm of cells 6 hr after infection
12917321 results report the identification of TIAR as a novel player in the regulation of calcitonin/CGRP alternative RNA processing

AA Sequence

MMEDDGQPRTLYVGNLSRDVTEVLILQLFSQIGPCKSCKMITEHTSNDPYCFVEFYEHRDAAAALAAMNG      1 - 70
RKILGKEVKVNWATTPSSQKKDTSNHFHVFVGDLSPEITTEDIKSAFAPFGKISDARVVKDMATGKSKGY     71 - 140
GFVSFYNKLDAENAIVHMGGQWLGGRQIRTNWATRKPPAPKSTQENNTKQLRFEDVVNQSSPKNCTVYCG    141 - 210
GIASGLTDQLMRQTFSPFGQIMEIRVFPEKGYSFVRFSTHESAAHAIVSVNGTTIEGHVVKCYWGKESPD    211 - 280
MTKNFQQVDYSQWGQWSQVYGNPQQYGQYMANGWQVPPYGVYGQPWNQQGFGVDQSPSAAWMGGFGAQPP    281 - 350
QGQAPPPVIPPPNQAGYGMASYQTQ                                                 351 - 375
//

Text Mined References (51)

PMID Year Title
26363455 2015 TIA-1 and TIAR interact with 5'-UTR of enterovirus 71 genome and facilitate viral replication.
24927121 2014 Genome-wide profiling reveals a role for T-cell intracellular antigens TIA1 and TIAR in the control of translational specificity in HeLa cells.
24766723 2014 Long-term reduction of T-cell intracellular antigens leads to increased beta-actin expression.
24566137 2014 HuR and TIA1/TIAL1 are involved in regulation of alternative splicing of SIRT1 pre-mRNA.
23603827 2013 Distinct binding properties of TIAR RRMs and linker region.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
21269460 2011 Initial characterization of the human central proteome.
21189287 2011 TIA1 prevents skipping of a critical exon associated with spinal muscular atrophy.
21048981 2010 iCLIP predicts the dual splicing effects of TIA-RNA interactions.
20980400 2010 TIAR and TIA-1 mRNA-binding proteins co-aggregate under conditions of rapid oxygen decline and extreme hypoxia and suppress the HIF-1? pathway.
20932473 2010 DNA damage activates a spatially distinct late cytoplasmic cell-cycle checkpoint network controlled by MK2-mediated RNA stabilization.
20675271 2010 Identification of chosen apoptotic (TIAR and TIA-1) markers expression in thyroid tissues from adolescents with immune and non-immune thyroid diseases.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19805546 2009 Amyotrophic lateral sclerosis-linked mutant SOD1 sequesters Hu antigen R (HuR) and TIA-1-related protein (TIAR): implications for impaired post-transcriptional regulation of vascular endothelial growth factor.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19110540 2009 TIA nuclear proteins regulate the alternate splicing of lysyl hydroxylase 2.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18456862 2008 A systematic analysis of intronic sequences downstream of 5' splice sites reveals a widespread role for U-rich motifs and TIA1/TIAL1 proteins in alternative splicing regulation.
18201561 2008 Structure of the central RNA recognition motif of human TIA-1 at 1.95A resolution.
17869012 2007 Contribution of TIA-1+ and granzyme B+ cytotoxic T lymphocytes to cryptal apoptosis and ulceration in active inflammatory bowel disease.
17682065 2007 Elucidation of a C-rich signature motif in target mRNAs of RNA-binding protein TIAR.
17512901 2007 Cooperative binding of TIA-1 and U1 snRNP in K-SAM exon splicing activation.
17488725 2007 Two isoforms of the T-cell intracellular antigen 1 (TIA-1) splicing factor display distinct splicing regulation activities. Control of TIA-1 isoform ratio by TIA-1-related protein.
17486099 2007 Competitive binding of AUF1 and TIAR to MYC mRNA controls its translation.
16890199 2006 Control of the ATP synthase beta subunit expression by RNA-binding proteins TIA-1, TIAR, and HuR.
16581801 2006 Translational control of cytochrome c by RNA-binding proteins TIA-1 and HuR.
16537914 2006 Translational repression by RNA-binding protein TIAR.
16243297 2005 A functional link between Disrupted-In-Schizophrenia 1 and the eukaryotic translation initiation factor 3.
16191398 2005 The RNA binding protein TIAR is involved in the regulation of human iNOS expression.
16091628 2005 Novel DNA-binding properties of the RNA-binding protein TIAR.
15592455 2005 Immunoaffinity profiling of tyrosine phosphorylation in cancer cells.
15514971 2005 IL-1beta induces stabilization of IL-8 mRNA in malignant breast cancer cells via the 3' untranslated region: Involvement of divergent RNA-binding factors HuR, KSRP and TIAR.
15304326 2004 Survival motor neuron protein facilitates assembly of stress granules.
15280467 2004 Herpes simplex virus 1 induces cytoplasmic accumulation of TIA-1/TIAR and both synthesis and cytoplasmic accumulation of tristetraprolin, two cellular proteins that bind and destabilize AU-rich RNAs.
14736875 2004 TIA proteins are necessary but not sufficient for the tissue-specific splicing of the myosin phosphatase targeting subunit 1.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12917321 2003 U1 snRNP-dependent function of TIAR in the regulation of alternative RNA processing of the human calcitonin/CGRP pre-mRNA.
12855701 2003 The proximal region of the 3'-untranslated region of cyclooxygenase-2 is recognized by a multimeric protein complex containing HuR, TIA-1, TIAR, and the heterogeneous nuclear ribonucleoprotein U.
12533540 2003 TIA-1 or TIAR is required for DT40 cell viability.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12426321 2003 Translational repression of human matrix metalloproteinases-13 by an alternatively spliced form of T-cell-restricted intracellular antigen-related protein (TIAR).
12414941 2002 Cell proteins TIA-1 and TIAR interact with the 3' stem-loop of the West Nile virus complementary minus-strand RNA and facilitate virus replication.
12356730 2002 Sendai virus trailer RNA binds TIAR, a cellular protein involved in virus-induced apoptosis.
11514562 2001 TIA-1 and TIAR activate splicing of alternative exons with weak 5' splice sites followed by a U-rich stretch on their own pre-mRNAs.
10700014 2000 Expression of the RNA-binding protein TIAR is increased in neurons after ischemic cerebral injury.
9207209 1997 An alternative form of nucleolysin binds to a T-cluster DNA in the silencer element of platelet factor 4 gene.
8576255 1996 Individual RNA recognition motifs of TIA-1 and TIAR have different RNA binding specificities.
7533298 1995 The RNA-binding protein TIAR is translocated from the nucleus to the cytoplasm during Fas-mediated apoptotic cell death.
1326761 1992 Identification and functional characterization of a TIA-1-related nucleolysin.