Property Summary

NCBI Gene PubMed Count 65
Grant Count 12
R01 Count 6
Funding $944,982.8
PubMed Score 42.97
PubTator Score 44.11

Knowledge Summary

Patent

No data available

Expression

Gene RIF (32)

PMID Text
25880619 TGF-beta1 and ELF protein are potential and reliable biomarkers for predicting prognosis in HCC patients after hepatic resection.
25632041 betaII spectrin is critical for normal myocyte electric activity. Dysfunction in the betaII spectrin-dependent cytoskeleton in cardiomyocytes contributes to human arrhythmia.
25496916 Spectrin, beta, non-erythrocytic 1 (SPTBN1) is identified to interact with HIV-1 Tat mutant Nullbasic in HeLa cells by LC MS/MS
25307947 decreased SPTBN1 and kallistatin gene expression associated with decreased relapse-free survival in hepatocellular carcinoma
25096061 in human HCC tissues, SPTBN1 expression correlated negatively with expression levels of STAT3, ATF3, and CREB2; SMAD3 expression correlated negatively with STAT3 expression
23460728 Spectrin, beta, non-erythrocytic 1 (SPTBN1) is identified to interact with HIV-1 Tat mutant Nullbasic in HeLa cells by LC MS/MS
23460728 Spectrin, beta, non-erythrocytic 1 (SPTBN1) is identified to interact with HIV-1 Tat mutant Nullbasic in HeLa cells by LC MS/MS
23460728 Spectrin, beta, non-erythrocytic 1 (SPTBN1) is identified to interact with HIV-1 Tat mutant Nullbasic in HeLa cells by LC MS/MS
23460728 Spectrin, beta, non-erythrocytic 1 (SPTBN1) is identified to interact with HIV-1 Tat mutant Nullbasic in HeLa cells by LC MS/MS
23460728 Knockdown of SPTBN1 by siRNA inhibits HIV-1 replication in primary macrophages
More...

AA Sequence

MTTTVATDYDNIEIQQQYSDVNNRWDVDDWDNENSSARLFERSRIKALADEREAVQKKTFTKWVNSHLAR      1 - 70
VSCRITDLYTDLRDGRMLIKLLEVLSGERLPKPTKGRMRIHCLENVDKALQFLKEQRVHLENMGSHDIVD     71 - 140
GNHRLTLGLIWTIILRFQIQDISVETEDNKEKKSAKDALLLWCQMKTAGYPNVNIHNFTTSWRDGMAFNA    141 - 210
LIHKHRPDLIDFDKLKKSNAHYNLQNAFNLAEQHLGLTKLLDPEDISVDHPDEKSIITYVVTYYHYFSKM    211 - 280
KALAVEGKRIGKVLDNAIETEKMIEKYESLASDLLEWIEQTIIILNNRKFANSLVGVQQQLQAFNTYRTV    281 - 350
EKPPKFTEKGNLEVLLFTIQSKMRANNQKVYMPREGKLISDINKAWERLEKAEHERELALRNELIRQEKL    351 - 420
EQLARRFDRKAAMRETWLSENQRLVSQDNFGFDLPAVEAATKKHEAIETDIAAYEERVQAVVAVARELEA    421 - 490
ENYHDIKRITARKDNVIRLWEYLLELLRARRQRLEMNLGLQKIFQEMLYIMDWMDEMKVLVLSQDYGKHL    491 - 560
LGVEDLLQKHTLVEADIGIQAERVRGVNASAQKFATDGEGYKPCDPQVIRDRVAHMEFCYQELCQLAAER    561 - 630
RARLEESRRLWKFFWEMAEEEGWIREKEKILSSDDYGKDLTSVMRLLSKHRAFEDEMSGRSGHFEQAIKE    631 - 700
GEDMIAEEHFGSEKIRERIIYIREQWANLEQLSAIRKKRLEEASLLHQFQADADDIDAWMLDILKIVSSS    701 - 770
DVGHDEYSTQSLVKKHKDVAEEIANYRPTLDTLHEQASALPQEHAESPDVRGRLSGIEERYKEVAELTRL    771 - 840
RKQALQDTLALYKMFSEADACELWIDEKEQWLNNMQIPEKLEDLEVIQHRFESLEPEMNNQASRVAVVNQ    841 - 910
IARQLMHSGHPSEKEIKAQQDKLNTRWSQFRELVDRKKDALLSALSIQNYHLECNETKSWIREKTKVIES    911 - 980
TQDLGNDLAGVMALQRKLTGMERDLVAIEAKLSDLQKEAEKLESEHPDQAQAILSRLAEISDVWEEMKTT    981 - 1050
LKNREASLGEASKLQQFLRDLDDFQSWLSRTQTAIASEDMPNTLTEAEKLLTQHENIKNEIDNYEEDYQK   1051 - 1120
MRDMGEMVTQGQTDAQYMFLRQRLQALDTGWNELHKMWENRQNLLSQSHAYQQFLRDTKQAEAFLNNQEY   1121 - 1190
VLAHTEMPTTLEGAEAAIKKQEDFMTTMDANEEKINAVVETGRRLVSDGNINSDRIQEKVDSIDDRHRKN   1191 - 1260
RETASELLMRLKDNRDLQKFLQDCQELSLWINEKMLTAQDMSYDEARNLHSKWLKHQAFMAELASNKEWL   1261 - 1330
DKIEKEGMQLISEKPETEAVVKEKLTGLHKMWEVLESTTQTKAQRLFDANKAELFTQSCADLDKWLHGLE   1331 - 1400
SQIQSDDYGKDLTSVNILLKKQQMLENQMEVRKKEIEELQSQAQALSQEGKSTDEVDSKRLTVQTKFMEL   1401 - 1470
LEPLNERKHNLLASKEIHQFNRDVEDEILWVGERMPLATSTDHGHNLQTVQLLIKKNQTLQKEIQGHQPR   1471 - 1540
IDDIFERSQNIVTDSSSLSAEAIRQRLADLKQLWGLLIEETEKRHRRLEEAHRAQQYYFDAAEAEAWMSE   1541 - 1610
QELYMMSEEKAKDEQSAVSMLKKHQILEQAVEDYAETVHQLSKTSRALVADSHPESERISMRQSKVDKLY   1611 - 1680
AGLKDLAEERRGKLDERHRLFQLNREVDDLEQWIAEREVVAGSHELGQDYEHVTMLQERFREFARDTGNI   1681 - 1750
GQERVDTVNHLADELINSGHSDAATIAEWKDGLNEAWADLLELIDTRTQILAASYELHKFYHDAKEIFGR   1751 - 1820
IQDKHKKLPEELGRDQNTVETLQRMHTTFEHDIQALGTQVRQLQEDAARLQAAYAGDKADDIQKRENEVL   1821 - 1890
EAWKSLLDACESRRVRLVDTGDKFRFFSMVRDLMLWMEDVIRQIEAQEKPRDVSSVELLMNNHQGIKAEI   1891 - 1960
DARNDSFTTCIELGKSLLARKHYASEEIKEKLLQLTEKRKEMIDKWEDRWEWLRLILEVHQFSRDASVAE   1961 - 2030
AWLLGQEPYLSSREIGQSVDEVEKLIKRHEAFEKSAATWDERFSALERLTTLELLEVRRQQEEEERKRRP   2031 - 2100
PSPEPSTKVSEEAESQQQWDTSKGEQVSQNGLPAEQGSPRMAETVDTSEMVNGATEQRTSSKESSPIPSP   2101 - 2170
TSDRKAKTALPAQSAATLPARTQETPSAQMEGFLNRKHEWEAHNKKASSRSWHNVYCVINNQEMGFYKDA   2171 - 2240
KTAASGIPYHSEVPVSLKEAVCEVALDYKKKKHVFKLRLNDGNEYLFQAKDDEEMNTWIQAISSAISSDK   2241 - 2310
HEVSASTQSTPASSRAQTLPTSVVTITSESSPGKREKDKEKDKEKRFSLFGKKK                   2311 - 2364
//

Text Mined References (84)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25880619 2015 The prognostic value of combined TGF-?1 and ELF in hepatocellular carcinoma.
25632041 2015 Dysfunction in the ?II spectrin-dependent cytoskeleton underlies human arrhythmia.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
25307947 2015 ?II-Spectrin (SPTBN1) suppresses progression of hepatocellular carcinoma and Wnt signaling by regulation of Wnt inhibitor kallistatin.
25096061 2014 Transcriptional regulation of STAT3 by SPTBN1 and SMAD3 in HCC through cAMP-response element-binding proteins ATF3 and CREB2.
24430505 2014 Genetic determinants of heel bone properties: genome-wide association meta-analysis and replication in the GEFOS/GENOMOS consortium.
24337748 2014 Guanylate binding protein 1-mediated interaction of T cell antigen receptor signaling with the cytoskeleton.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24117850 2014 A conserved sequence in calmodulin regulated spectrin-associated protein 1 links its interaction with spectrin and calmodulin to neurite outgrowth.
More...