Property Summary

NCBI Gene PubMed Count 67
PubMed Score 46.52
PubTator Score 44.11

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Fractures, Bone 13 0.0 0.0
Weight Gain 100 0.0 0.0
Disease Target Count Z-score Confidence
Globe disease 67 0.0 2.2
Osteoporosis 363 0.0 3.0
Disease Target Count Z-score Confidence
Doyne honeycomb retinal dystrophy 9 3.378 1.7

Expression

  Differential Expression (34)

Disease log2 FC p
acute myeloid leukemia 1.100 2.3e-02
adrenocortical carcinoma -1.501 8.3e-04
adult high grade glioma -1.200 4.8e-02
astrocytoma -1.200 1.3e-09
Astrocytoma, Pilocytic -1.100 4.0e-06
atypical teratoid / rhabdoid tumor -1.300 6.0e-05
autosomal dominant Emery-Dreifuss muscul... 1.157 9.4e-03
breast carcinoma -1.100 2.0e-11
cutaneous lupus erythematosus -1.200 1.3e-03
Down syndrome 1.600 7.7e-03
Duchenne muscular dystrophy 1.369 9.4e-08
ductal carcinoma in situ -2.400 1.9e-04
ependymoma -1.300 1.6e-02
esophageal adenocarcinoma 1.600 2.1e-02
glioblastoma -1.100 5.3e-09
group 3 medulloblastoma -1.700 5.3e-03
hepatocellular carcinoma -1.100 2.6e-04
intraductal papillary-mucinous neoplasm ... 1.100 4.6e-02
invasive ductal carcinoma -2.400 2.0e-03
lung adenocarcinoma -1.100 2.7e-13
lung cancer -1.400 1.4e-03
medulloblastoma, large-cell -1.300 2.2e-03
Multiple myeloma 1.364 2.2e-02
non-small cell lung cancer -1.452 2.1e-16
oligodendroglioma -1.300 9.5e-08
osteosarcoma 2.178 6.5e-04
ovarian cancer -3.400 1.0e-11
pancreatic cancer 1.300 3.0e-03
Polycystic ovary syndrome -1.003 1.3e-02
primary pancreatic ductal adenocarcinoma 1.792 5.0e-04
psoriasis -2.200 7.2e-05
subependymal giant cell astrocytoma -2.223 4.9e-03
tuberculosis and treatment for 6 months 2.000 5.1e-05
Waldenstrons macroglobulinemia 1.498 2.0e-02

Gene RIF (31)

AA Sequence

MTTTVATDYDNIEIQQQYSDVNNRWDVDDWDNENSSARLFERSRIKALADEREAVQKKTFTKWVNSHLAR      1 - 70
VSCRITDLYTDLRDGRMLIKLLEVLSGERLPKPTKGRMRIHCLENVDKALQFLKEQRVHLENMGSHDIVD     71 - 140
GNHRLTLGLIWTIILRFQIQDISVETEDNKEKKSAKDALLLWCQMKTAGYPNVNIHNFTTSWRDGMAFNA    141 - 210
LIHKHRPDLIDFDKLKKSNAHYNLQNAFNLAEQHLGLTKLLDPEDISVDHPDEKSIITYVVTYYHYFSKM    211 - 280
KALAVEGKRIGKVLDNAIETEKMIEKYESLASDLLEWIEQTIIILNNRKFANSLVGVQQQLQAFNTYRTV    281 - 350
EKPPKFTEKGNLEVLLFTIQSKMRANNQKVYMPREGKLISDINKAWERLEKAEHERELALRNELIRQEKL    351 - 420
EQLARRFDRKAAMRETWLSENQRLVSQDNFGFDLPAVEAATKKHEAIETDIAAYEERVQAVVAVARELEA    421 - 490
ENYHDIKRITARKDNVIRLWEYLLELLRARRQRLEMNLGLQKIFQEMLYIMDWMDEMKVLVLSQDYGKHL    491 - 560
LGVEDLLQKHTLVEADIGIQAERVRGVNASAQKFATDGEGYKPCDPQVIRDRVAHMEFCYQELCQLAAER    561 - 630
RARLEESRRLWKFFWEMAEEEGWIREKEKILSSDDYGKDLTSVMRLLSKHRAFEDEMSGRSGHFEQAIKE    631 - 700
GEDMIAEEHFGSEKIRERIIYIREQWANLEQLSAIRKKRLEEASLLHQFQADADDIDAWMLDILKIVSSS    701 - 770
DVGHDEYSTQSLVKKHKDVAEEIANYRPTLDTLHEQASALPQEHAESPDVRGRLSGIEERYKEVAELTRL    771 - 840
RKQALQDTLALYKMFSEADACELWIDEKEQWLNNMQIPEKLEDLEVIQHRFESLEPEMNNQASRVAVVNQ    841 - 910
IARQLMHSGHPSEKEIKAQQDKLNTRWSQFRELVDRKKDALLSALSIQNYHLECNETKSWIREKTKVIES    911 - 980
TQDLGNDLAGVMALQRKLTGMERDLVAIEAKLSDLQKEAEKLESEHPDQAQAILSRLAEISDVWEEMKTT    981 - 1050
LKNREASLGEASKLQQFLRDLDDFQSWLSRTQTAIASEDMPNTLTEAEKLLTQHENIKNEIDNYEEDYQK   1051 - 1120
MRDMGEMVTQGQTDAQYMFLRQRLQALDTGWNELHKMWENRQNLLSQSHAYQQFLRDTKQAEAFLNNQEY   1121 - 1190
VLAHTEMPTTLEGAEAAIKKQEDFMTTMDANEEKINAVVETGRRLVSDGNINSDRIQEKVDSIDDRHRKN   1191 - 1260
RETASELLMRLKDNRDLQKFLQDCQELSLWINEKMLTAQDMSYDEARNLHSKWLKHQAFMAELASNKEWL   1261 - 1330
DKIEKEGMQLISEKPETEAVVKEKLTGLHKMWEVLESTTQTKAQRLFDANKAELFTQSCADLDKWLHGLE   1331 - 1400
SQIQSDDYGKDLTSVNILLKKQQMLENQMEVRKKEIEELQSQAQALSQEGKSTDEVDSKRLTVQTKFMEL   1401 - 1470
LEPLNERKHNLLASKEIHQFNRDVEDEILWVGERMPLATSTDHGHNLQTVQLLIKKNQTLQKEIQGHQPR   1471 - 1540
IDDIFERSQNIVTDSSSLSAEAIRQRLADLKQLWGLLIEETEKRHRRLEEAHRAQQYYFDAAEAEAWMSE   1541 - 1610
QELYMMSEEKAKDEQSAVSMLKKHQILEQAVEDYAETVHQLSKTSRALVADSHPESERISMRQSKVDKLY   1611 - 1680
AGLKDLAEERRGKLDERHRLFQLNREVDDLEQWIAEREVVAGSHELGQDYEHVTMLQERFREFARDTGNI   1681 - 1750
GQERVDTVNHLADELINSGHSDAATIAEWKDGLNEAWADLLELIDTRTQILAASYELHKFYHDAKEIFGR   1751 - 1820
IQDKHKKLPEELGRDQNTVETLQRMHTTFEHDIQALGTQVRQLQEDAARLQAAYAGDKADDIQKRENEVL   1821 - 1890
EAWKSLLDACESRRVRLVDTGDKFRFFSMVRDLMLWMEDVIRQIEAQEKPRDVSSVELLMNNHQGIKAEI   1891 - 1960
DARNDSFTTCIELGKSLLARKHYASEEIKEKLLQLTEKRKEMIDKWEDRWEWLRLILEVHQFSRDASVAE   1961 - 2030
AWLLGQEPYLSSREIGQSVDEVEKLIKRHEAFEKSAATWDERFSALERLTTLELLEVRRQQEEEERKRRP   2031 - 2100
PSPEPSTKVSEEAESQQQWDTSKGEQVSQNGLPAEQGSPRMAETVDTSEMVNGATEQRTSSKESSPIPSP   2101 - 2170
TSDRKAKTALPAQSAATLPARTQETPSAQMEGFLNRKHEWEAHNKKASSRSWHNVYCVINNQEMGFYKDA   2171 - 2240
KTAASGIPYHSEVPVSLKEAVCEVALDYKKKKHVFKLRLNDGNEYLFQAKDDEEMNTWIQAISSAISSDK   2241 - 2310
HEVSASTQSTPASSRAQTLPTSVVTITSESSPGKREKDKEKDKEKRFSLFGKKK                   2311 - 2364
//

Text Mined References (86)

PMID Year Title