Property Summary

NCBI Gene PubMed Count 22
Grant Count 13
R01 Count 7
Funding $2,269,945.97
PubMed Score 17.32
PubTator Score 16.24

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
mucosa-associated lymphoid tissue lympho... 1.133 0.018

Gene RIF (5)

PMID Text
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
16407168 PDE1B2 regulates a subset of phenotypic changes that occur upon phorbol-12-myristate-13-acetate-induced differentiation and likely also plays a role in differentiated macrophages by regulating agonist-stimulated cGMP levels
15625104 Selective up-regulation of PDE1B2 upon monocyte-to-macrophage differentiation.
11156964 HIV-1 Tat decreases the intracellular levels of cAMP and CREB ser-133 phosphorylation through a signal transduction pathway involving sequential activation of phosphatidylinositol 3-kinase, AKT, and cyclic nucleoside phosphodiesterases

AA Sequence

MELSPRSPPEMLEESDCPSPLELKSAPSKKMWIKLRSLLRYMVKQLENGEINIEELKKNLEYTASLLEAV      1 - 70
YIDETRQILDTEDELQELRSDAVPSEVRDWLASTFTQQARAKGRRAEEKPKFRSIVHAVQAGIFVERMFR     71 - 140
RTYTSVGPTYSTAVLNCLKNLDLWCFDVFSLNQAADDHALRTIVFELLTRHNLISRFKIPTVFLMSFLDA    141 - 210
LETGYGKYKNPYHNQIHAADVTQTVHCFLLRTGMVHCLSEIELLAIIFAAAIHDYEHTGTTNSFHIQTKS    211 - 280
ECAIVYNDRSVLENHHISSVFRLMQDDEMNIFINLTKDEFVELRALVIEMVLATDMSCHFQQVKTMKTAL    281 - 350
QQLERIDKPKALSLLLHAADISHPTKQWLVHSRWTKALMEEFFRQGDKEAELGLPFSPLCDRTSTLVAQS    351 - 420
QIGFIDFIVEPTFSVLTDVAEKSVQPLADEDSKSKNQPSFQWRQPSLDVEVGDPNPDVVSFRSTWVKRIQ    421 - 490
ENKQKWKERAASGITNQMSIDELSPCEEEAPPSPAEDEHNQNGNLD                            491 - 536
//

Text Mined References (24)

PMID Year Title
23129425 2012 Phosphodiesterases in neurodegenerative disorders.
21044950 2011 Genome-wide YFP fluorescence complementation screen identifies new regulators for telomere signaling in human cells.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20493887 2010 Quantitative comparison of phosphodiesterase mRNA distribution in human brain and peripheral tissues.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17726023 2007 Cyclic nucleotide phosphodiesterase PDE1C1 in human cardiac myocytes.
16407168 2006 PDE1B2 regulates cGMP and a subset of the phenotypic characteristics acquired upon macrophage differentiation from a monocyte.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15625104 2005 Selective up-regulation of PDE1B2 upon monocyte-to-macrophage differentiation.
More...