Property Summary

NCBI Gene PubMed Count 6
PubMed Score 60.27
PubTator Score 2.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
pituitary cancer 1972 7.6805316496622E-8
osteosarcoma 7933 1.34149578716104E-5
atypical teratoid/rhabdoid tumor 1095 3.0869423782246E-5
Pick disease 1893 0.00178203061627947
subependymal giant cell astrocytoma 2287 0.00621443571432701
astrocytic glioma 2241 0.0205162388862237
progressive supranuclear palsy 674 0.0218576583434037
ependymoma 2514 0.0239067399924666

Expression

  Differential Expression (8)

Disease log2 FC p
astrocytic glioma -1.200 0.021
ependymoma -1.500 0.024
osteosarcoma 1.116 0.000
atypical teratoid/rhabdoid tumor -1.300 0.000
subependymal giant cell astrocytoma -1.614 0.006
Pick disease -1.100 0.002
progressive supranuclear palsy -1.100 0.022
pituitary cancer 2.700 0.000

Synonym

Accession Q00LT1 B9EJD4
Symbols RP36

Gene

  Ortholog (5)

Gene RIF (2)

PMID Text
23805042 The identification of a third mutation in PRCD confirms its role in the pathogenesis of retinitis pigmentosa.
20507925 The identification of a second pathogenic mutation of PRCD in multiple retinitis pigmentosa (RP) patients confirms the role of PRCD in the aetiology of RP in humans.

AA Sequence

MCTTLFLLSTLAMLWRRRFANRVQPEPSDVDGAARGSSLDADPQSSGREKEPLK                      1 - 54
//

Text Mined References (6)

PMID Year Title
23805042 2013 Identification of a novel mutation in the PRCD gene causing autosomal recessive retinitis pigmentosa in a Turkish family.
20507925 2010 Identification of a prevalent founder mutation in an Israeli Muslim Arab village confirms the role of PRCD in the aetiology of retinitis pigmentosa in humans.
16938425 2006 Identical mutation in a novel retinal gene causes progressive rod-cone degeneration in dogs and retinitis pigmentosa in humans.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.