Property Summary

NCBI Gene PubMed Count 8
PubMed Score 58.91
PubTator Score 2.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
astrocytic glioma -1.200 2.1e-02
atypical teratoid/rhabdoid tumor -1.300 3.1e-05
ependymoma -1.500 2.4e-02
osteosarcoma 1.116 1.3e-05
Pick disease -1.100 1.8e-03
pituitary cancer 2.700 7.7e-08
progressive supranuclear palsy -1.100 2.2e-02
subependymal giant cell astrocytoma -1.614 6.2e-03

Gene RIF (3)

AA Sequence

MCTTLFLLSTLAMLWRRRFANRVQPEPSDVDGAARGSSLDADPQSSGREKEPLK                      1 - 54
//

Text Mined References (8)

PMID Year Title