Property Summary

NCBI Gene PubMed Count 11
Grant Count 24
R01 Count 14
Funding $3,241,135.58
PubMed Score 53.74
PubTator Score 25.74

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
tuberculosis and treatment for 3 months -1.200 0.000
intraductal papillary-mucinous neoplasm ... -1.300 0.032
pancreatic cancer -1.100 0.001
fibroadenoma -2.000 0.019
interstitial cystitis -1.600 0.000
gastric carcinoma -1.900 0.037
ductal carcinoma in situ -1.300 0.003
invasive ductal carcinoma -1.100 0.021
ovarian cancer -1.900 0.000
pituitary cancer -1.200 0.002

MLP Assay (2)

AID Type Active / Inconclusive / Inactive Description
504319 confirmatory 32 / 0 / 13 Luminescence-based biochemical high throughput dose response assay for inhibitors of the interaction of the lipase co-activator protein, abhydrolase domain containing 5 (ABHD5) with perilipin-5 (MLDP; PLIN5) (2K validation set)
652130 confirmatory 20 / 0 / 28 Late stage luminescence-based biochemical dose response assay for inhibitors of the interaction of the lipase co-activator protein, abhydrolase domain containing 5 (ABHD5) with perilipin-5 (MLDP; PLIN5) produced in HEK293T cells (ROUND 2)

Gene RIF (8)

PMID Text
25054327 PLIN5 was significantly colocated with ATGL, mitochondria and CGI-58, indicating a close association between the key lipolytic effectors in resting skeletal muscle.
24535284 Perilipin 5 as a lipid droplet protein adapted to mitochondrial energy utilization
23129790 Sprint interval and traditional endurance training increase net intramuscular triglyceride breakdown and expression of perilipin 2 and 5
22667335 PLIN5 likely plays an important role in intramyocellular lipid accumulation and oxidation, both of which increase with endurance training in human skeletal muscle.
22127648 The lipid droplet coat protein perilipin 5 also localizes to muscle mitochondria.
21632259 Perilipin 5 is the most recently established family member, highly expressed in oxidative tissues and could play an important role in regulating LD TAG hydrolysis in oxidative mammalian tissues. [Review]
21393244 interaction of ATGL with CGI-58 increased lipolysis, whereas interaction of ATGL with perilipin 5 decreased lipolysis.
19602560 Results indicate involvement of OXPAT and ADRP in muscular lipid accumulation and type 2 diabetes.

AA Sequence

MSEEEAAQIPRSSVWEQDQQNVVQRVVALPLVRATCTAVCDVYSAAKDRHPLLGSACRLAENCVCGLTTR      1 - 70
ALDHAQPLLEHLQPQLATMNSLACRGLDKLEEKLPFLQQPSETVVTSAKDVVASSVTGVVDLARRGRRWS     71 - 140
VELKRSVSHAVDVVLEKSEELVDHFLPMTEEELAALAAEAEGPEVGSVEDQRRQQGYFVRLGSLSARIRH    141 - 210
LAYEHSVGKLRQSKHRAQDTLAQLQETLELIDHMQCGVTPTAPACPGKVHELWGEWGQRPPESRRRSQAE    211 - 280
LETLVLSRSLTQELQGTVEALESSVRGLPAGAQEKVAEVRRSVDALQTAFADARCFRDVPAAALAEGRGR    281 - 350
VAHAHACVDELLELVVQAVPLPWLVGPFAPILVERPEPLPDLADLVDEVIGGPDPRWAHLDWPAQQRAWE    351 - 420
AEHRDGSGNGDGDRMGVAGDICEQEPETPSCPVKHTLMPELDF                               421 - 463
//

Text Mined References (15)

PMID Year Title
25054327 2014 Cellular localization and associations of the major lipolytic proteins in human skeletal muscle at rest and during exercise.
24535284 2014 Perilipin 5, a lipid droplet protein adapted to mitochondrial energy utilization.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23129790 2013 Sprint interval and traditional endurance training increase net intramuscular triglyceride breakdown and expression of perilipin 2 and 5.
22667335 2012 Perilipin family (PLIN) proteins in human skeletal muscle: the effect of sex, obesity, and endurance training.
22127648 2012 The lipid droplet coat protein perilipin 5 also localizes to muscle mitochondria.
21632259 2011 Oxidative tissue: perilipin 5 links storage with the furnace.
21393244 2011 Unique regulation of adipose triglyceride lipase (ATGL) by perilipin 5, a lipid droplet-associated protein.
19638644 2010 Adoption of PERILIPIN as a unifying nomenclature for the mammalian PAT-family of intracellular lipid storage droplet proteins.
19602560 2009 Adipocyte differentiation-related protein and OXPAT in rat and human skeletal muscle: involvement in lipid accumulation and type 2 diabetes mellitus.
More...