Property Summary

NCBI Gene PubMed Count 23
PubMed Score 81.40
PubTator Score 48.90

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
Duchenne muscular dystrophy 602 1.12102061571327E-8
ovarian cancer 8492 2.56157209190752E-5
pancreatic carcinoma 567 1.36138107635363E-4
pancreatic cancer 2300 1.36138107635365E-4
nasopharyngeal carcinoma 1056 2.32049518447405E-4
psoriasis 6685 6.67364716718937E-4
dermatomyositis 967 0.00105345142718491
lung adenocarcinoma 2714 0.00323321236282157
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.0221883010572194
Waldenstrons macroglobulinemia 765 0.0222668580848778
osteosarcoma 7933 0.0330233392891508
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0350481633635964
ependymoma 2514 0.0432322872135478

Expression

  Differential Expression (13)

Disease log2 FC p
pancreatic cancer 1.600 0.000
Waldenstrons macroglobulinemia 1.322 0.022
ependymoma -1.100 0.043
psoriasis 1.100 0.001
osteosarcoma 1.057 0.033
Duchenne muscular dystrophy 1.389 0.000
intraductal papillary-mucinous carcinoma... -1.100 0.022
intraductal papillary-mucinous neoplasm ... -2.200 0.035
pancreatic carcinoma 1.600 0.000
lung adenocarcinoma -1.100 0.003
nasopharyngeal carcinoma 1.400 0.000
ovarian cancer -1.700 0.000
dermatomyositis 1.300 0.001

Gene RIF (3)

PMID Text
16777077 DRG-1 may contribute to the dopamine-induced cell growth, which is negatively regulated by NADE
12739005 suppresses cell growth in vivo, when expressed in cultured cells
11830582 Structure-function analysis of NADE: identification of regions that mediate nerve growth factor-induced apoptosis

AA Sequence

MANIHQENEEMEQPMQNGEEDRPLGGGEGHQPAGNRRGQARRLAPNFRWAIPNRQINDGMGGDGDDMEIF      1 - 70
MEEMREIRRKLRELQLRNCLRILMGELSNHHDHHDEFCLMP                                  71 - 111
//

Text Mined References (24)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
21516116 2011 Next-generation sequencing to generate interactome datasets.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17355907 2007 The TSC1 gene product hamartin interacts with NADE.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16777077 2006 Characterization of human dopamine responsive protein DRG-1 that binds to p75NTR-associated cell death executor NADE.
16221301 2005 Mammalian BEX, WEX and GASP genes: coding and non-coding chimaerism sustained by gene conversion events.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15958283 2005 Characterization of the Bex gene family in humans, mice, and rats.
15772651 2005 The DNA sequence of the human X chromosome.
More...