Property Summary

NCBI Gene PubMed Count 24
PubMed Score 88.05
PubTator Score 48.90

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
dermatomyositis 1.300 1.1e-03
Duchenne muscular dystrophy 1.389 1.1e-08
ependymoma -1.100 4.3e-02
intraductal papillary-mucinous carcinoma... -1.100 2.2e-02
intraductal papillary-mucinous neoplasm ... -2.200 3.5e-02
lung adenocarcinoma -1.100 3.2e-03
nasopharyngeal carcinoma 1.400 2.3e-04
osteosarcoma 1.057 3.3e-02
ovarian cancer -1.700 2.6e-05
pancreatic cancer 1.600 1.4e-04
pancreatic carcinoma 1.600 1.4e-04
psoriasis 1.100 6.7e-04
Waldenstrons macroglobulinemia 1.322 2.2e-02

Gene RIF (4)

AA Sequence

MANIHQENEEMEQPMQNGEEDRPLGGGEGHQPAGNRRGQARRLAPNFRWAIPNRQINDGMGGDGDDMEIF      1 - 70
MEEMREIRRKLRELQLRNCLRILMGELSNHHDHHDEFCLMP                                  71 - 111
//

Text Mined References (25)

PMID Year Title