Property Summary

Ligand Count 1,448
NCBI Gene PubMed Count 1,335
PubMed Score 2313.88
PubTator Score 2386.90

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Cancer 2499 6.785 3.4
Disease Target Count Z-score Confidence
Lipoma 32 5.518 2.8
Fibrous dysplasia 15 3.171 1.6

Expression

  Differential Expression (19)

Disease log2 FC p
osteosarcoma 2.388 5.3e-03
active Crohn's disease 1.022 3.1e-02
acute quadriplegic myopathy 1.871 4.1e-07
Amyotrophic lateral sclerosis 1.066 2.1e-06
atypical teratoid / rhabdoid tumor 1.200 3.6e-06
autosomal dominant Emery-Dreifuss muscul... 1.253 2.1e-04
colon cancer -2.200 2.7e-04
gastric cancer 1.200 5.3e-04
glioblastoma 1.200 1.5e-05
hepatocellular carcinoma 1.400 6.7e-05
juvenile dermatomyositis 1.355 5.6e-11
lung cancer -1.200 1.2e-02
malignant mesothelioma -1.300 1.5e-03
ovarian cancer 1.100 8.2e-03
pancreatic cancer 1.300 7.3e-03
pancreatic carcinoma 1.300 7.3e-03
primitive neuroectodermal tumor 1.100 6.0e-04
psoriasis -2.500 4.9e-05
subependymal giant cell astrocytoma 1.471 1.0e-02

Gene

PDB

1YCR   4HFZ   5MNJ   2F1Y   2FOP   3MQS   2VJE   2VJF   1RV1   1T4E   1T4F   1Z1M   2AXI   2C6A   2C6B   2GV2   2HDP   2LZG   2M86   2MPS   2RUH   3EQS   3G03   3IUX   3IWY   3JZK   3JZR   3JZS   3LBK   3LBL   3LNJ   3LNZ   3TJ2   3TPX   3TU1   3V3B   3VBG   3VZV   3W69   4DIJ   4ERE   4ERF   4HBM   4HG7   4JV7   4JV9   4JVE   4JVR   4JWR   4MDN   4MDQ   4OAS   4OBA   4OCC   4ODE   4ODF   4OGN   4OGT   4OGV   4OQ3   4QO4   4QOC   4UD7   4UE1   4UMN   4WT2   4XXB   4ZFI   4ZGK   4ZYC   4ZYF   4ZYI   5AFG   5C5A   5HMH   5HMI   5HMK   5J7F   5J7G   5LAV   5LAW   5LAY   5LAZ   5LN2   5SWK   5TRF  

  Ortholog (1)

Species Source Disease
Macaque OMA Inparanoid

Protein-protein Interaction (3)

Gene RIF (1278)

AA Sequence

MCNTNMSVPTDGAVTTSQIPASEQETLVRPKPLLLKLLKSVGAQKDTYTMKEVLFYLGQYIMTKRLYDEK      1 - 70
QQHIVYCSNDLLGDLFGVPSFSVKEHRKIYTMIYRNLVVVNQQESSDSGTSVSENRCHLEGGSDQKDLVQ     71 - 140
ELQEEKPSSSHLVSRPSTSSRRRAISETEENSDELSGERQRKRHKSDSISLSFDESLALCVIREICCERS    141 - 210
SSSESTGTPSNPDLDAGVSEHSGDWLDQDSVSDQFSVEFEVESLDSEDYSLSEEGQELSDEDDEVYQVTV    211 - 280
YQAGESDTDSFEEDPEISLADYWKCTSCNEMNPPLPSHCNRCWALRENWLPEDKGKDKGEISEKAKLENS    281 - 350
TQAEEGFDVPDCKKTIVNDSRESCVEENDDKITQASQSQESEDYSQPSTSSSIIYSSQEDVKEFEREETQ    351 - 420
DKEESVESSLPLNAIEPCVICQGRPKNGCIVHGKTGHLMACFTCAKKLKKRNKPCPVCRQPIQMIVLTYF    421 - 490
P//

Text Mined References (1345)

PMID Year Title