Property Summary

NCBI Gene PubMed Count 62
PubMed Score 69.32
PubTator Score 174.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
psoriasis 6694 5.3e-34
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Boutonneuse fever 7 3.42 1.7

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis 1.200 5.3e-34

Protein-protein Interaction (7)

Gene RIF (38)

AA Sequence

MASGRARCTRKLRNWVVEQVESGQFPGVCWDDTAKTMFRIPWKHAGKQDFREDQDAAFFKAWAIFKGKYK      1 - 70
EGDTGGPAVWKTRLRCALNKSSEFKEVPERGRMDVAEPYKVYQLLPPGIVSGQPGTQKVPSKRQHSSVSS     71 - 140
ERKEEEDAMQNCTLSPSVLQDSLNNEEEGASGGAVHSDIGSSSSSSSPEPQEVTDTTEAPFQGDQRSLEF    141 - 210
LLPPEPDYSLLLTFIYNGRVVGEAQVQSLDCRLVAEPSGSESSMEQVLFPKPGPLEPTQRLLSQLERGIL    211 - 280
VASNPRGLFVQRLCPIPISWNAPQAPPGPGPHLLPSNECVELFRTAYFCRDLVRYFQGLGPPPKFQVTLN    281 - 350
FWEESHGSSHTPQNLITVKMEQAFARYLLEQTPEQQAAILSLV                               351 - 393
//

Text Mined References (62)

PMID Year Title