Property Summary

NCBI Gene PubMed Count 58
Grant Count 54
R01 Count 36
Funding $3,591,813.01
PubMed Score 61.70
PubTator Score 174.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Disease Z-score Confidence
Boutonneuse fever 7 3.477 1.7
psoriasis 6,685

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis 1.200 0.000

Gene RIF (34)

PMID Text
26397446 Interferonstimulated gene factor 3 complex, which consists of STAT1, STAT2 and IRF9, is required for the induction of SAMHD1 expression by IFN-alpha in SMMC-7721 cells.
26216956 U-ISGF3 induced by IFN-lambdas and -beta drives prolonged expression of a set of IFN-stimulated genes during HCV infection
25319116 IRF9 is a vascular injury-response molecule that promotes VSMC proliferation. IRF9 expression is upregulated during neointima formation.
25278262 DC-SIGN-induced ISGF3 by fucose-based PAMPs has an essential role in driving IL-27 and subsequent TFH polarization, which might be harnessed for vaccination design
25156627 STAT2 and IRF9 overexpression is sufficient to drive interferon-related DNA damage signature expression upon cell crowding.
25150882 IRF9 mediated myocardial reperfusion injury
23913484 IL6 is an inducer of IRF9 expression in prostate cancer and a sensitizer for the antiproliferative effects of IFNalpha2.
22902549 The hepatitis C virus (HCV) non-structural 5A (NS5A) protein, which is known to modulate the IFN response, competes with IRF9 for CypA binding and can prevent the formation of IRF9-CypA complexes.
21957129 HDAC1 and HDAC2 differentially modulate STAT activity in response to IFNalpha2: while they are required for the induction of ISGF3-responsive genes, they impair the transcription of STAT3-dependent genes.
21697347 Western blot and electrophoretic mobility-shift assays identified the interferon-stimulated gene factor-3 (ISGF-3) components STAT1 and IRF-9 as the proximal targets of human herpesvirus 8 vIRF-2 activity.
More...

AA Sequence

MASGRARCTRKLRNWVVEQVESGQFPGVCWDDTAKTMFRIPWKHAGKQDFREDQDAAFFKAWAIFKGKYK      1 - 70
EGDTGGPAVWKTRLRCALNKSSEFKEVPERGRMDVAEPYKVYQLLPPGIVSGQPGTQKVPSKRQHSSVSS     71 - 140
ERKEEEDAMQNCTLSPSVLQDSLNNEEEGASGGAVHSDIGSSSSSSSPEPQEVTDTTEAPFQGDQRSLEF    141 - 210
LLPPEPDYSLLLTFIYNGRVVGEAQVQSLDCRLVAEPSGSESSMEQVLFPKPGPLEPTQRLLSQLERGIL    211 - 280
VASNPRGLFVQRLCPIPISWNAPQAPPGPGPHLLPSNECVELFRTAYFCRDLVRYFQGLGPPPKFQVTLN    281 - 350
FWEESHGSSHTPQNLITVKMEQAFARYLLEQTPEQQAAILSLV                               351 - 393
//

Text Mined References (58)

PMID Year Title
26397446 2015 Interferon-stimulated gene factor 3 complex is required for the induction of sterile ? motif and HD domain-containing protein 1 expression by interferon-? in SMMC-7721 cells.
26216956 2015 Roles of unphosphorylated ISGF3 in HCV infection and interferon responsiveness.
25319116 2014 Interferon regulatory factor 9 is critical for neointima formation following vascular injury.
25278262 2014 Fucose-based PAMPs prime dendritic cells for follicular T helper cell polarization via DC-SIGN-dependent IL-27 production.
25156627 2015 Cell crowding induces interferon regulatory factor 9, which confers resistance to chemotherapeutic drugs.
25150882 2014 Interferon regulatory factor 9 is an essential mediator of heart dysfunction and cell death following myocardial ischemia/reperfusion injury.
24882218 2014 Unanchored K48-linked polyubiquitin synthesized by the E3-ubiquitin ligase TRIM6 stimulates the interferon-IKK? kinase-mediated antiviral response.
24065129 2013 IFN?-dependent increases in STAT1, STAT2, and IRF9 mediate resistance to viruses and DNA damage.
23913484 2013 IL6 sensitizes prostate cancer to the antiproliferative effect of IFN?2 through IRF9.
22902549 2013 HCV NS5A and IRF9 compete for CypA binding.
More...