Property Summary

NCBI Gene PubMed Count 20
PubMed Score 68.79
PubTator Score 49.88

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
astrocytic glioma -1.400 1.2e-03
Astrocytoma, Pilocytic -1.100 3.0e-04
atypical teratoid / rhabdoid tumor -1.800 8.4e-09
ependymoma -1.700 2.8e-03
glioblastoma -1.100 6.1e-03
group 3 medulloblastoma -1.500 1.8e-02
lung cancer 2.000 5.3e-03
malignant mesothelioma 3.800 2.6e-08
medulloblastoma, large-cell -1.800 1.1e-06
oligodendroglioma -1.200 1.3e-02
osteosarcoma 1.729 1.1e-05
pediatric high grade glioma -1.400 3.4e-05
pituitary cancer 1.300 2.9e-05
primitive neuroectodermal tumor -1.100 3.1e-03

Gene RIF (9)

AA Sequence

MWLGRRALCALVLLLACASLGLLYASTRDAPGLRLPLAPWAPPQSPRRPELPDLAPEPRYAHIPVRIKEQ      1 - 70
VVGLLAWNNCSCESSGGGLPLPFQKQVRAIDLTKAFDPAELRAASATREQEFQAFLSRSQSPADQLLIAP     71 - 140
ANSPLQYPLQGVEVQPLRSILVPGLSLQAASGQEVYQVNLTASLGTWDVAGEVTGVTLTGEGQADLTLVS    141 - 210
PGLDQLNRQLQLVTYSSRSYQTNTADTVRFSTEGHEAAFTIRIRHPPNPRLYPPGSLPQGAQYNISALVT    211 - 280
IATKTFLRYDRLRALITSIRRFYPTVTVVIADDSDKPERVSGPYVEHYLMPFGKGWFAGRNLAVSQVTTK    281 - 350
YVLWVDDDFVFTARTRLERLVDVLERTPLDLVGGAVREISGFATTYRQLLSVEPGAPGLGNCLRQRRGFH    351 - 420
HELVGFPGCVVTDGVVNFFLARTDKVREVGFDPRLSRVAHLEFFLDGLGSLRVGSCSDVVVDHASKLKLP    421 - 490
WTSRDAGAETYARYRYPGSLDESQMAKHRLLFFKHRLQCMTSQ                               491 - 533
//

Text Mined References (23)

PMID Year Title