Property Summary

NCBI Gene PubMed Count 14
PubMed Score 8.65
PubTator Score 9.62

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
ovarian cancer 8520 7.9e-11
psoriasis 6694 4.4e-08
cystic fibrosis 1696 7.5e-05
medulloblastoma, large-cell 6241 2.0e-03
Breast cancer 3578 2.1e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
Obstructive sleep apnea 26 3.757 1.9

Expression

  Differential Expression (5)

Disease log2 FC p
Breast cancer -1.100 2.1e-02
cystic fibrosis 1.221 7.5e-05
medulloblastoma, large-cell 1.100 2.0e-03
ovarian cancer 1.300 7.9e-11
psoriasis 1.600 4.4e-08

AA Sequence

MGPLSAPPCTQHITWKGLLLTASLLNFWNLPTTAQVIIEAKPPKVSEGKDVLLLVHNLPQNLTGYIWYKG      1 - 70
QMTDLYHYITSYVVHGQIIYGPAYSGRETVYSNASLLIQNVTQEDAGSYTLHIIKRGDGTGGVTGYFTVT     71 - 140
LYSETPKPSISSSNLNPREVMEAVRLICDPETPDASYLWLLNGQNLPMTHRLQLSKTNRTLYLFGVTKYI    141 - 210
AGPYECEIRNPVSASRSDPVTLNLLPKLPMPYITINNLNPREKKDVLAFTCEPKSRNYTYIWWLNGQSLP    211 - 280
VSPRVKRPIENRILILPSVTRNETGPYQCEIRDRYGGIRSNPVTLNVLYGPDLPRIYPSFTYYRSGENLD    281 - 350
LSCFADSNPPAEYSWTINGKFQLSGQKLFIPQITTNHSGLYACSVRNSATGKEISKSMIVKVSETASPQV    351 - 420
TYAGPNTWFQEILLL                                                           421 - 435
//

Text Mined References (15)

PMID Year Title