Property Summary

NCBI Gene PubMed Count 16
PubMed Score 10.49
PubTator Score 0.75

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
malignant mesothelioma 3232 7.4e-09
ovarian cancer 8520 7.5e-08
Atopic dermatitis 952 4.4e-04
cystic fibrosis 1696 7.9e-04
diabetes mellitus 1728 1.0e-03
spina bifida 1074 3.6e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7

Expression

  Differential Expression (6)

Disease log2 FC p
Atopic dermatitis -1.300 4.4e-04
cystic fibrosis 1.011 7.9e-04
diabetes mellitus 1.500 1.0e-03
malignant mesothelioma -4.100 7.4e-09
ovarian cancer 1.400 7.5e-08
spina bifida -1.065 3.6e-02

AA Sequence

MGPLSAPPCTQRITWKGVLLTASLLNFWNPPTTAQVTIEAQPPKVSEGKDVLLLVHNLPQNLAGYIWYKG      1 - 70
QMTYLYHYITSYVVDGQRIIYGPAYSGRERVYSNASLLIQNVTQEDAGSYTLHIIKRRDGTGGVTGHFTF     71 - 140
TLHLETPKPSISSSNLNPREAMEAVILTCDPATPAASYQWWMNGQSLPMTHRLQLSKTNRTLFIFGVTKY    141 - 210
IAGPYECEIRNPVSASRSDPVTLNLLPKLSKPYITINNLNPRENKDVLTFTCEPKSKNYTYIWWLNGQSL    211 - 280
PVSPRVKRPIENRILILPNVTRNETGPYQCEIRDRYGGIRSDPVTLNVLYGPDLPSIYPSFTYYRSGENL    281 - 350
YLSCFAESNPRAQYSWTINGKFQLSGQKLSIPQITTKHSGLYACSVRNSATGKESSKSITVKVSDWILP     351 - 419
//

Text Mined References (17)

PMID Year Title