Property Summary

NCBI Gene PubMed Count 16
PubMed Score 9.85
PubTator Score 0.75

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
malignant mesothelioma -4.100 0.000
cystic fibrosis 1.011 0.001
Atopic dermatitis -1.300 0.000
diabetes mellitus 1.500 0.001
spina bifida -1.065 0.036
ovarian cancer 1.400 0.000

AA Sequence

MGPLSAPPCTQRITWKGVLLTASLLNFWNPPTTAQVTIEAQPPKVSEGKDVLLLVHNLPQNLAGYIWYKG      1 - 70
QMTYLYHYITSYVVDGQRIIYGPAYSGRERVYSNASLLIQNVTQEDAGSYTLHIIKRRDGTGGVTGHFTF     71 - 140
TLHLETPKPSISSSNLNPREAMEAVILTCDPATPAASYQWWMNGQSLPMTHRLQLSKTNRTLFIFGVTKY    141 - 210
IAGPYECEIRNPVSASRSDPVTLNLLPKLSKPYITINNLNPRENKDVLTFTCEPKSKNYTYIWWLNGQSL    211 - 280
PVSPRVKRPIENRILILPNVTRNETGPYQCEIRDRYGGIRSDPVTLNVLYGPDLPSIYPSFTYYRSGENL    281 - 350
YLSCFAESNPRAQYSWTINGKFQLSGQKLSIPQITTKHSGLYACSVRNSATGKESSKSITVKVSDWILP     351 - 419
//

Text Mined References (17)

PMID Year Title
23469002 2013 Pregnancy-specific glycoproteins bind integrin ?IIb?3 and inhibit the platelet-fibrinogen interaction.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
15057824 2004 The DNA sequence and biology of human chromosome 19.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10737800 2000 Shotgun sequencing of the human transcriptome with ORF expressed sequence tags.
9645429 1998 A single human cell expresses all messenger ribonucleic acids: the arrow of time in a cell.
8003489 1994 Pregnancy-specific glycoprotein gene expression and the induction by 5-bromo-2'-deoxyuridine.
7851896 1994 The pregnancy-specific glycoprotein (PSG) gene cluster on human chromosome 19: fine structure of the 11 PSG genes and identification of 6 new genes forming a third subgroup within the carcinoembryonic antigen (CEA) family.
7851895 1994 Gene organization of the pregnancy-specific glycoprotein region on human chromosome 19: assembly and analysis of a 700-kb cosmid contig spanning the region.
7794280 1995 Characterization of cDNA encoding novel pregnancy-specific glycoprotein variants.
More...