Property Summary

NCBI Gene PubMed Count 78
PubMed Score 191.04
PubTator Score 97.10

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
acute quadriplegic myopathy 1157 3.96054453937456E-7
Breast cancer 3099 1.60170259031315E-6
medulloblastoma, large-cell 6234 3.1366889865233E-6
atypical teratoid/rhabdoid tumor 1095 1.31248520037623E-5
cystic fibrosis 1670 4.24302356705763E-5
osteosarcoma 7933 7.36612234291114E-5
group 3 medulloblastoma 2254 1.15360569162637E-4
ovarian cancer 8492 1.4322960483439E-4
Multiple myeloma 1328 2.09385342033575E-4
psoriasis 6685 9.90453821613913E-4
adrenocortical carcinoma 1427 0.00132411227279852
astrocytoma 1493 0.00211966797962226
Waldenstrons macroglobulinemia 765 0.00445565094958319
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.0107928291827194
gastric cancer 436 0.0184314982601937

Expression

  Differential Expression (15)

Disease log2 FC p
gastric cancer -1.200 0.018
Waldenstrons macroglobulinemia 1.828 0.004
Multiple myeloma 2.536 0.000
psoriasis -1.100 0.001
osteosarcoma -2.196 0.000
group 3 medulloblastoma 2.100 0.000
astrocytoma 1.400 0.002
medulloblastoma, large-cell 1.600 0.000
acute quadriplegic myopathy 1.506 0.000
adrenocortical carcinoma -1.331 0.001
intraductal papillary-mucinous carcinoma... 1.100 0.011
cystic fibrosis -1.300 0.000
atypical teratoid/rhabdoid tumor 1.100 0.000
Breast cancer -1.100 0.000
ovarian cancer 1.700 0.000

Synonym

Accession Q00839 O75507 Q8N174 Q96HY9 Q9BQ09 hnRNP U
Symbols SAFA
HNRPU
SAF-A
U21.1
hnRNP U
HNRNPU-AS1

Gene

PDB

1ZRJ  

  Ortholog (10)

Species Source
Macaque OMA Inparanoid
Mouse OMA Inparanoid
Rat OMA Inparanoid
Dog OMA Inparanoid
Cow OMA Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA Inparanoid

Gene RIF (34)

PMID Text
27041735 mutual regulatory mechanisms exist between PP4 and SAF-A. Interactions between PP4 and SAF-A played a role in prometaphase/metaphase transition.
26881882 CENP-W interacts with hnRNPU and may contribute to kinetochore-microtubule attachment in mitotic cells.
25986610 both phosphorylation and dephosphorylation of SAF-A serine 59 by PLK1 and PP2A, respectively, are required for accurate and timely exit from mitosis.
25378556 Nuclear TDP-43 becomes neurotoxic by escaping from the inhibitory regulation by hnRNP-U or hnRNP-A2. hnRNP-U inhibits TDP-43-mediated alterations in splicing of POLDIP3 mRNA.
23811339 demonstrate that H19 inhibits RNA Pol II-mediated transcription by disrupting the hnRNP U-actin complex
23396972 Induction of caspase-9b expression is due to activation of hnRNP L via phosphorylation to compete/inhibit hnRNP U association with exon 3 of Casp9 mRNA.
23255807 Human hnRNP U1 protein binding to splicing-incompetent U1 snRNA binding sites suffices to augment cross-exon interactions and spicing at 3'ssA2, leading to modulate HIV-1 vpr mRNA and Vpr protein expression
23125841 Human hnRNP U1 protein binding to splicing-incompetent U1 snRNA binding sites suffices to augment cross-exon interactions and spicing at 3'ssA2, leading to modulate HIV-1 vpr mRNA and Vpr protein expression
22944692 Human hnRNP U1 protein binding to splicing-incompetent U1 snRNA binding sites suffices to augment cross-exon interactions and spicing at 3'ssA2, leading to modulate HIV-1 vpr mRNA and Vpr protein expression
22902625 the hnRNP-U protection of cells after oxidative stress is largely due to enhancement of NEIL1-mediated repair.
More...

AA Sequence

MSSSPVNVKKLKVSELKEELKKRRLSDKGLKAELMERLQAALDDEEAGGRPAMEPGNGSLDLGGDSAGRS      1 - 70
GAGLEQEAAAGGDEEEEEEEEEEEGISALDGDQMELGEENGAAGAADSGPMEEEEAASEDENGDDQGFQE     71 - 140
GEDELGDEEEGAGDENGHGEQQPQPPATQQQQPQQQRGAAKEAAGKSSGPTSLFAVTVAPPGARQGQQQA    141 - 210
GGKKKAEGGGGGGRPGAPAAGDGKTEQKGGDKKRGVKRPREDHGRGYFEYIEENKYSRAKSPQPPVEEED    211 - 280
EHFDDTVVCLDTYNCDLHFKISRDRLSASSLTMESFAFLWAGGRASYGVSKGKVCFEMKVTEKIPVRHLY    281 - 350
TKDIDIHEVRIGWSLTTSGMLLGEEEFSYGYSLKGIKTCNCETEDYGEKFDENDVITCFANFESDEVELS    351 - 420
YAKNGQDLGVAFKISKEVLAGRPLFPHVLCHNCAVEFNFGQKEKPYFPIPEEYTFIQNVPLEDRVRGPKG    421 - 490
PEEKKDCEVVMMIGLPGAGKTTWVTKHAAENPGKYNILGTNTIMDKMMVAGFKKQMADTGKLNTLLQRAP    491 - 560
QCLGKFIEIAARKKRNFILDQTNVSAAAQRRKMCLFAGFQRKAVVVCPKDEDYKQRTQKKAEVEGKDLPE    561 - 630
HAVLKMKGNFTLPEVAECFDEITYVELQKEEAQKLLEQYKEESKKALPPEKKQNTGSKKSNKNKSGKNQF    631 - 700
NRGGGHRGRGGFNMRGGNFRGGAPGNRGGYNRRGNMPQRGGGGGGSGGIGYPYPRAPVFPGRGSYSNRGN    701 - 770
YNRGGMPNRGNYNQNFRGRGNNRGYKNQSQGYNQWQQGQFWGQKPWSQHYHQGYY                   771 - 825
//

Text Mined References (95)

PMID Year Title
27041735 2016 Protein phosphatase 4 plays dual roles during cell proliferation.
26881882 2016 Centromere Protein (CENP)-W Interacts with Heterogeneous Nuclear Ribonucleoprotein (hnRNP) U and May Contribute to Kinetochore-Microtubule Attachment in Mitotic Cells.
25986610 2015 Phosphorylation of SAF-A/hnRNP-U Serine 59 by Polo-Like Kinase 1 Is Required for Mitosis.
25616961 2015 ALS-linked mutations in ubiquilin-2 or hnRNPA1 reduce interaction between ubiquilin-2 and hnRNPA1.
25378556 2015 Nuclear TDP-43 causes neuronal toxicity by escaping from the inhibitory regulation by hnRNPs.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
25114211 2014 Mapping of SUMO sites and analysis of SUMOylation changes induced by external stimuli.
24965446 2014 Host factors that interact with the pestivirus N-terminal protease, Npro, are components of the ribonucleoprotein complex.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
More...