Property Summary

NCBI Gene PubMed Count 89
PubMed Score 207.79
PubTator Score 97.10

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
acute quadriplegic myopathy 1.506 4.0e-07
adrenocortical carcinoma -1.331 1.3e-03
astrocytoma 1.300 6.9e-04
atypical teratoid/rhabdoid tumor 1.100 1.3e-05
Breast cancer -1.100 1.6e-06
cystic fibrosis -1.300 4.2e-05
gastric cancer -1.200 1.8e-02
group 3 medulloblastoma 1.600 1.3e-03
intraductal papillary-mucinous carcinoma... 1.100 1.1e-02
medulloblastoma, large-cell 1.600 3.1e-06
Multiple myeloma 1.770 1.2e-04
osteosarcoma -2.196 7.4e-05
ovarian cancer -1.300 1.2e-05
psoriasis -1.100 9.9e-04
Waldenstrons macroglobulinemia 1.828 4.5e-03

Gene RIF (37)

AA Sequence

MSSSPVNVKKLKVSELKEELKKRRLSDKGLKAELMERLQAALDDEEAGGRPAMEPGNGSLDLGGDSAGRS      1 - 70
GAGLEQEAAAGGDEEEEEEEEEEEGISALDGDQMELGEENGAAGAADSGPMEEEEAASEDENGDDQGFQE     71 - 140
GEDELGDEEEGAGDENGHGEQQPQPPATQQQQPQQQRGAAKEAAGKSSGPTSLFAVTVAPPGARQGQQQA    141 - 210
GGKKKAEGGGGGGRPGAPAAGDGKTEQKGGDKKRGVKRPREDHGRGYFEYIEENKYSRAKSPQPPVEEED    211 - 280
EHFDDTVVCLDTYNCDLHFKISRDRLSASSLTMESFAFLWAGGRASYGVSKGKVCFEMKVTEKIPVRHLY    281 - 350
TKDIDIHEVRIGWSLTTSGMLLGEEEFSYGYSLKGIKTCNCETEDYGEKFDENDVITCFANFESDEVELS    351 - 420
YAKNGQDLGVAFKISKEVLAGRPLFPHVLCHNCAVEFNFGQKEKPYFPIPEEYTFIQNVPLEDRVRGPKG    421 - 490
PEEKKDCEVVMMIGLPGAGKTTWVTKHAAENPGKYNILGTNTIMDKMMVAGFKKQMADTGKLNTLLQRAP    491 - 560
QCLGKFIEIAARKKRNFILDQTNVSAAAQRRKMCLFAGFQRKAVVVCPKDEDYKQRTQKKAEVEGKDLPE    561 - 630
HAVLKMKGNFTLPEVAECFDEITYVELQKEEAQKLLEQYKEESKKALPPEKKQNTGSKKSNKNKSGKNQF    631 - 700
NRGGGHRGRGGFNMRGGNFRGGAPGNRGGYNRRGNMPQRGGGGGGSGGIGYPYPRAPVFPGRGSYSNRGN    701 - 770
YNRGGMPNRGNYNQNFRGRGNNRGYKNQSQGYNQWQQGQFWGQKPWSQHYHQGYY                   771 - 825
//

Text Mined References (113)

PMID Year Title