Property Summary

NCBI Gene PubMed Count 78
Grant Count 42
R01 Count 32
Funding $3,495,916.88
PubMed Score 191.04
PubTator Score 97.10

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
gastric cancer -1.200 0.018
Waldenstrons macroglobulinemia 1.828 0.004
Multiple myeloma 2.536 0.000
psoriasis -1.100 0.001
osteosarcoma -2.196 0.000
group 3 medulloblastoma 2.100 0.000
astrocytoma 1.400 0.002
medulloblastoma, large-cell 1.600 0.000
acute quadriplegic myopathy 1.506 0.000
adrenocortical carcinoma -1.331 0.001
intraductal papillary-mucinous carcinoma... 1.100 0.011
cystic fibrosis -1.300 0.000
atypical teratoid/rhabdoid tumor 1.100 0.000
Breast cancer -1.100 0.000
ovarian cancer 1.700 0.000

Gene RIF (37)

PMID Text
27041735 mutual regulatory mechanisms exist between PP4 and SAF-A. Interactions between PP4 and SAF-A played a role in prometaphase/metaphase transition.
26881882 CENP-W interacts with hnRNPU and may contribute to kinetochore-microtubule attachment in mitotic cells.
25986610 both phosphorylation and dephosphorylation of SAF-A serine 59 by PLK1 and PP2A, respectively, are required for accurate and timely exit from mitosis.
25378556 Nuclear TDP-43 becomes neurotoxic by escaping from the inhibitory regulation by hnRNP-U or hnRNP-A2. hnRNP-U inhibits TDP-43-mediated alterations in splicing of POLDIP3 mRNA.
23811339 demonstrate that H19 inhibits RNA Pol II-mediated transcription by disrupting the hnRNP U-actin complex
23396972 Induction of caspase-9b expression is due to activation of hnRNP L via phosphorylation to compete/inhibit hnRNP U association with exon 3 of Casp9 mRNA.
23255807 Human hnRNP U1 protein binding to splicing-incompetent U1 snRNA binding sites suffices to augment cross-exon interactions and spicing at 3'ssA2, leading to modulate HIV-1 vpr mRNA and Vpr protein expression
23125841 Human hnRNP U1 protein binding to splicing-incompetent U1 snRNA binding sites suffices to augment cross-exon interactions and spicing at 3'ssA2, leading to modulate HIV-1 vpr mRNA and Vpr protein expression
23125841 Human hnRNP U1 protein binding to splicing-incompetent U1 snRNA binding sites suffices to augment cross-exon interactions and spicing at 3'ssA2, leading to modulate HIV-1 vpr mRNA and Vpr protein expression
23125841 Human hnRNP U1 protein binding to splicing-incompetent U1 snRNA binding sites suffices to augment cross-exon interactions and spicing at 3'ssA2, leading to modulate HIV-1 vpr mRNA and Vpr protein expression
More...

AA Sequence

MSSSPVNVKKLKVSELKEELKKRRLSDKGLKAELMERLQAALDDEEAGGRPAMEPGNGSLDLGGDSAGRS      1 - 70
GAGLEQEAAAGGDEEEEEEEEEEEGISALDGDQMELGEENGAAGAADSGPMEEEEAASEDENGDDQGFQE     71 - 140
GEDELGDEEEGAGDENGHGEQQPQPPATQQQQPQQQRGAAKEAAGKSSGPTSLFAVTVAPPGARQGQQQA    141 - 210
GGKKKAEGGGGGGRPGAPAAGDGKTEQKGGDKKRGVKRPREDHGRGYFEYIEENKYSRAKSPQPPVEEED    211 - 280
EHFDDTVVCLDTYNCDLHFKISRDRLSASSLTMESFAFLWAGGRASYGVSKGKVCFEMKVTEKIPVRHLY    281 - 350
TKDIDIHEVRIGWSLTTSGMLLGEEEFSYGYSLKGIKTCNCETEDYGEKFDENDVITCFANFESDEVELS    351 - 420
YAKNGQDLGVAFKISKEVLAGRPLFPHVLCHNCAVEFNFGQKEKPYFPIPEEYTFIQNVPLEDRVRGPKG    421 - 490
PEEKKDCEVVMMIGLPGAGKTTWVTKHAAENPGKYNILGTNTIMDKMMVAGFKKQMADTGKLNTLLQRAP    491 - 560
QCLGKFIEIAARKKRNFILDQTNVSAAAQRRKMCLFAGFQRKAVVVCPKDEDYKQRTQKKAEVEGKDLPE    561 - 630
HAVLKMKGNFTLPEVAECFDEITYVELQKEEAQKLLEQYKEESKKALPPEKKQNTGSKKSNKNKSGKNQF    631 - 700
NRGGGHRGRGGFNMRGGNFRGGAPGNRGGYNRRGNMPQRGGGGGGSGGIGYPYPRAPVFPGRGSYSNRGN    701 - 770
YNRGGMPNRGNYNQNFRGRGNNRGYKNQSQGYNQWQQGQFWGQKPWSQHYHQGYY                   771 - 825
//

Text Mined References (95)

PMID Year Title
27041735 2016 Protein phosphatase 4 plays dual roles during cell proliferation.
26881882 2016 Centromere Protein (CENP)-W Interacts with Heterogeneous Nuclear Ribonucleoprotein (hnRNP) U and May Contribute to Kinetochore-Microtubule Attachment in Mitotic Cells.
25986610 2015 Phosphorylation of SAF-A/hnRNP-U Serine 59 by Polo-Like Kinase 1 Is Required for Mitosis.
25616961 2015 ALS-linked mutations in ubiquilin-2 or hnRNPA1 reduce interaction between ubiquilin-2 and hnRNPA1.
25378556 2015 Nuclear TDP-43 causes neuronal toxicity by escaping from the inhibitory regulation by hnRNPs.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
25114211 2014 Mapping of SUMO sites and analysis of SUMOylation changes induced by external stimuli.
24965446 2014 Host factors that interact with the pestivirus N-terminal protease, Npro, are components of the ribonucleoprotein complex.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
More...