Property Summary

Ligand Count 64
NCBI Gene PubMed Count 38
PubMed Score 132.41
PubTator Score 113.75

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
Atopic dermatitis -1.200 1.1e-02
atypical teratoid / rhabdoid tumor -1.200 7.1e-03
glioblastoma -1.200 3.2e-04
interstitial cystitis -1.200 9.7e-04
intraductal papillary-mucinous neoplasm ... 3.100 1.1e-04
nasopharyngeal carcinoma 1.800 8.6e-03
psoriasis -1.500 1.7e-19

Gene RIF (10)

AA Sequence

MAAAAKPNNLSLVVHGPGDLRLENYPIPEPGPNEVLLRMHSVGICGSDVHYWEYGRIGNFIVKKPMVLGH      1 - 70
EASGTVEKVGSSVKHLKPGDRVAIEPGAPRENDEFCKMGRYNLSPSIFFCATPPDDGNLCRFYKHNAAFC     71 - 140
YKLPDNVTFEEGALIEPLSVGIHACRRGGVTLGHKVLVCGAGPIGMVTLLVAKAMGAAQVVVTDLSATRL    141 - 210
SKAKEIGADLVLQISKESPQEIARKVEGQLGCKPEVTIECTGAEASIQAGIYATRSGGNLVLVGLGSEMT    211 - 280
TVPLLHAAIREVDIKGVFRYCNTWPVAISMLASKSVNVKPLVTHRFPLEKALEAFETFKKGLGLKIMLKC    281 - 350
DPSDQNP                                                                   351 - 357
//

Text Mined References (43)

PMID Year Title