Property Summary

NCBI Gene PubMed Count 18
Grant Count 20
R01 Count 5
Funding $2,824,347.48
PubMed Score 214.57
PubTator Score 69.22

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
Multiple myeloma 1.747 0.000
malignant mesothelioma -1.200 0.000
psoriasis -1.100 0.000
osteosarcoma -1.323 0.007
glioblastoma -1.500 0.000
medulloblastoma -1.600 0.000
atypical teratoid / rhabdoid tumor -1.900 0.000
medulloblastoma, large-cell -2.300 0.000
primitive neuroectodermal tumor -1.500 0.000
pancreatic ductal adenocarcinoma liver m... -1.227 0.003
non-small cell lung cancer -1.269 0.000
lung cancer -1.800 0.000
Breast cancer 2.400 0.030
pediatric high grade glioma -1.200 0.000
non primary Sjogren syndrome sicca 1.100 0.038
lung adenocarcinoma -1.300 0.000
Pick disease -1.300 0.000
ovarian cancer -2.100 0.000

Gene RIF (4)

PMID Text
22795047 To determine the pathogenesis and treatment response of major depressive disorder. REEP5 gene polymorphisms may influence antidepressant treatment response in MDD.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
18976975 Knockdown of receptor accessory protein 5 (REEP5) by siRNA has both activating and inhibiting activities on HIV-1 replication in HeLa P4/R5 cells, suggesting a regulatory role in HIV replication

AA Sequence

MSAAMRERFDRFLHEKNCMTDLLAKLEAKTGVNRSFIALGVIGLVALYLVFGYGASLLCNLIGFGYPAYI      1 - 70
SIKAIESPNKEDDTQWLTYWVVYGVFSIAEFFSDIFLSWFPFYYMLKCGFLLWCMAPSPSNGAELLYKRI     71 - 140
IRPFFLKHESQMDSVVKDLKDKAKETADAITKEAKKATVNLLGEEKKST                         141 - 189
//

Text Mined References (27)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23969831 2013 Protrudin binds atlastins and endoplasmic reticulum-shaping proteins and regulates network formation.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22795047 Association of APC and REEP5 gene polymorphisms with major depression disorder and treatment response to antidepressants in a Han Chinese population.
21269460 2011 Initial characterization of the human central proteome.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19665976 2009 A class of dynamin-like GTPases involved in the generation of the tubular ER network.
More...