Property Summary

NCBI Gene PubMed Count 18
PubMed Score 219.06
PubTator Score 69.22

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
adult high grade glioma -1.100 2.8e-03
atypical teratoid / rhabdoid tumor -1.900 4.1e-08
Breast cancer 2.400 3.0e-02
glioblastoma -1.200 1.1e-05
group 3 medulloblastoma -1.200 1.1e-03
lung adenocarcinoma -1.300 1.6e-09
lung cancer -1.400 1.0e-02
malignant mesothelioma -1.200 9.6e-07
medulloblastoma, large-cell -2.300 2.4e-04
Multiple myeloma 1.747 1.3e-04
non primary Sjogren syndrome sicca 1.100 3.8e-02
non-small cell lung cancer -1.269 2.6e-23
osteosarcoma 1.203 8.4e-03
ovarian cancer -2.100 2.2e-07
pancreatic ductal adenocarcinoma liver m... -1.227 2.8e-03
Pick disease -1.300 1.3e-05
primitive neuroectodermal tumor -1.500 8.4e-05
psoriasis -1.100 2.3e-04

Synonym

Accession Q00765 B7Z681 D3DT04 Q04198 Q5QGT0 Q9BWH9
Symbols DP1
TB2
YOP1
Yip2e
D5S346
C5orf18

Gene

PANTHER Protein Class (1)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 MGI Phenotype (1)

Gene RIF (4)

AA Sequence

MSAAMRERFDRFLHEKNCMTDLLAKLEAKTGVNRSFIALGVIGLVALYLVFGYGASLLCNLIGFGYPAYI      1 - 70
SIKAIESPNKEDDTQWLTYWVVYGVFSIAEFFSDIFLSWFPFYYMLKCGFLLWCMAPSPSNGAELLYKRI     71 - 140
IRPFFLKHESQMDSVVKDLKDKAKETADAITKEAKKATVNLLGEEKKST                         141 - 189
//

Text Mined References (27)

PMID Year Title