Property Summary

NCBI Gene PubMed Count 53
Grant Count 88
R01 Count 65
Funding $8,850,621.35
PubMed Score 136.74
PubTator Score 89.83

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
malignant mesothelioma 1.500 0.000
psoriasis 1.300 0.000
subependymal giant cell astrocytoma 1.091 0.022
lung carcinoma -1.300 0.000

Synonym

Accession Q00722 A8K6J2 B9EGH5
Symbols PLC-beta-2

Gene

PDB

2FJU   2ZKM  

 GWAS Trait (1)

Gene RIF (42)

PMID Text
26468229 Gnb isoforms control a signaling pathway comprising Rac1, Plcbeta2, and Plcbeta3 leading to LFA-1 activation and neutrophil arrest in vivo
24903829 Neuropeptide Y decreased PLCB2 expression in HUVECs.
24330829 high expression of CD133 in triple-negative breast cancer (TNBC)-derived cells correlates with high invasive potential; aggressive properties of CD133high cells are mitigated by PLC-beta2 which down-modulates expression of CD133 and may play a role in preventing metastatic progression of CD133 positive TNBC
23690479 In this study, we show that staphylococcal enterotoxin B activates a Galphaq and PLCbeta2-dependent pathway in human T cells
23625927 WDR26 functions as a scaffolding protein to promote PLCbeta2 membrane translocation and interaction with Gbetagamma, thereby enhancing PLCbeta2 activation in leukocytes.
23006664 PLCbeta2 is enriched in the cytosol.
22905097 gamma-synuclein has a role in promoting a more robust G protein Galphaq activation of PLCbeta2
22728827 GPCR activation of Ras and PI3Kc in neutrophils depends on PLCb2/b3 and the RasGEF RasGRP4.
21940795 WDR36 acts as a scaffold protein tethering a G-protein-coupled receptor, Galphaq and phospholipase C beta 2 in a signalling complex
20842205 Phospholipase C/protein kinase C pathway-dependent phosphorylation of p44/42 and JNK MAP kinases is partially involved in IL-1beta induction by HIV-1 Tat
More...

AA Sequence

MSLLNPVLLPPKVKAYLSQGERFIKWDDETTVASPVILRVDPKGYYLYWTYQSKEMEFLDITSIRDTRFG      1 - 70
KFAKMPKSQKLRDVFNMDFPDNSFLLKTLTVVSGPDMVDLTFHNFVSYKENVGKAWAEDVLALVKHPLTA     71 - 140
NASRSTFLDKILVKLKMQLNSEGKIPVKNFFQMFPADRKRVEAALSACHLPKGKNDAINPEDFPEPVYKS    141 - 210
FLMSLCPRPEIDEIFTSYHAKAKPYMTKEHLTKFINQKQRDSRLNSLLFPPARPDQVQGLIDKYEPSGIN    211 - 280
AQRGQLSPEGMVWFLCGPENSVLAQDKLLLHHDMTQPLNHYFINSSHNTYLTAGQFSGLSSAEMYRQVLL    281 - 350
SGCRCVELDCWKGKPPDEEPIITHGFTMTTDIFFKEAIEAIAESAFKTSPYPIILSFENHVDSPRQQAKM    351 - 420
AEYCRTIFGDMLLTEPLEKFPLKPGVPLPSPEDLRGKILIKNKKNQFSGPTSSSKDTGGEAEGSSPPSAP    421 - 490
AGEGTVWAGEEGTELEEEEVEEEEEEESGNLDEEEIKKMQSDEGTAGLEVTAYEEMSSLVNYIQPTKFVS    491 - 560
FEFSAQKNRSYVISSFTELKAYDLLSKASVQFVDYNKRQMSRIYPKGTRMDSSNYMPQMFWNAGCQMVAL    561 - 630
NFQTMDLPMQQNMAVFEFNGQSGYLLKHEFMRRPDKQFNPFSVDRIDVVVATTLSITVISGQFLSERSVR    631 - 700
TYVEVELFGLPGDPKRRYRTKLSPSTNSINPVWKEEPFVFEKILMPELASLRVAVMEEGNKFLGHRIIPI    701 - 770
NALNSGYHHLCLHSESNMPLTMPALFIFLEMKDYIPGAWADLTVALANPIKFFSAHDTKSVKLKEAMGGL    771 - 840
PEKPFPLASPVASQVNGALAPTSNGSPAARAGAREEAMKEAAEPRTASLEELRELKGVVKLQRRHEKELR    841 - 910
ELERRGARRWEELLQRGAAQLAELGPPGVGGVGACKLGPGKGSRKKRSLPREESAGAAPGEGPEGVDGRV    911 - 980
RELKDRLELELLRQGEEQYECVLKRKEQHVAEQISKMMELAREKQAAELKALKETSENDTKEMKKKLETK    981 - 1050
RLERIQGMTKVTTDKMAQERLKREINNSHIQEVVQVIKQMTENLERHQEKLEEKQAACLEQIREMEKQFQ   1051 - 1120
KEALAEYEARMKGLEAEVKESVRACLRTCFPSEAKDKPERACECPPELCEQDPLIAKADAQESRL        1121 - 1185
//

Text Mined References (57)

PMID Year Title
26468229 2016 Gnb isoforms control a signaling pathway comprising Rac1, Plc?2, and Plc?3 leading to LFA-1 activation and neutrophil arrest in vivo.
25056061 2014 Biological insights from 108 schizophrenia-associated genetic loci.
24903829 2014 Neuropeptide Y reduces the expression of PLCB2, PLCD1 and selected PLC genes in cultured human endothelial cells.
24330829 2013 In triple negative breast tumor cells, PLC-?2 promotes the conversion of CD133high to CD133low phenotype and reduces the CD133-related invasiveness.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23690479 2013 Superantigen-induced steroid resistance depends on activation of phospholipase C?2.
23625927 2013 WDR26 functions as a scaffolding protein to promote G??-mediated phospholipase C ?2 (PLC?2) activation in leukocytes.
23006664 2013 PLC? isoforms differ in their subcellular location and their CT-domain dependent interaction with G?q.
22905097 2012 ?-Synuclein interacts with phospholipase C?2 to modulate G protein activation.
22728827 2012 GPCR activation of Ras and PI3Kc in neutrophils depends on PLCb2/b3 and the RasGEF RasGRP4.
More...