Property Summary

NCBI Gene PubMed Count 53
PubMed Score 136.74
PubTator Score 89.83

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
lung carcinoma 2844 4.22445395553386E-14
malignant mesothelioma 3163 2.23865191117208E-6
psoriasis 6685 3.64266027548566E-4
subependymal giant cell astrocytoma 2287 0.0223327140352353
Disease Target Count Z-score Confidence
Schizophrenia 503 0.0 1.0

Expression

  Differential Expression (4)

Disease log2 FC p
malignant mesothelioma 1.500 0.000
psoriasis 1.300 0.000
subependymal giant cell astrocytoma 1.091 0.022
lung carcinoma -1.300 0.000

Synonym

Accession Q00722 A8K6J2 B9EGH5
Symbols PLC-beta-2

Gene

PDB

2FJU   2ZKM  

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG
Opossum EggNOG Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA Inparanoid

 GWAS Trait (1)

Gene RIF (42)

PMID Text
26468229 Gnb isoforms control a signaling pathway comprising Rac1, Plcbeta2, and Plcbeta3 leading to LFA-1 activation and neutrophil arrest in vivo
24903829 Neuropeptide Y decreased PLCB2 expression in HUVECs.
24330829 high expression of CD133 in triple-negative breast cancer (TNBC)-derived cells correlates with high invasive potential; aggressive properties of CD133high cells are mitigated by PLC-beta2 which down-modulates expression of CD133 and may play a role in preventing metastatic progression of CD133 positive TNBC
23690479 In this study, we show that staphylococcal enterotoxin B activates a Galphaq and PLCbeta2-dependent pathway in human T cells
23625927 WDR26 functions as a scaffolding protein to promote PLCbeta2 membrane translocation and interaction with Gbetagamma, thereby enhancing PLCbeta2 activation in leukocytes.
23006664 PLCbeta2 is enriched in the cytosol.
22905097 gamma-synuclein has a role in promoting a more robust G protein Galphaq activation of PLCbeta2
22728827 GPCR activation of Ras and PI3Kc in neutrophils depends on PLCb2/b3 and the RasGEF RasGRP4.
21940795 WDR36 acts as a scaffold protein tethering a G-protein-coupled receptor, Galphaq and phospholipase C beta 2 in a signalling complex
20842205 Phospholipase C/protein kinase C pathway-dependent phosphorylation of p44/42 and JNK MAP kinases is partially involved in IL-1beta induction by HIV-1 Tat
More...

AA Sequence

MSLLNPVLLPPKVKAYLSQGERFIKWDDETTVASPVILRVDPKGYYLYWTYQSKEMEFLDITSIRDTRFG      1 - 70
KFAKMPKSQKLRDVFNMDFPDNSFLLKTLTVVSGPDMVDLTFHNFVSYKENVGKAWAEDVLALVKHPLTA     71 - 140
NASRSTFLDKILVKLKMQLNSEGKIPVKNFFQMFPADRKRVEAALSACHLPKGKNDAINPEDFPEPVYKS    141 - 210
FLMSLCPRPEIDEIFTSYHAKAKPYMTKEHLTKFINQKQRDSRLNSLLFPPARPDQVQGLIDKYEPSGIN    211 - 280
AQRGQLSPEGMVWFLCGPENSVLAQDKLLLHHDMTQPLNHYFINSSHNTYLTAGQFSGLSSAEMYRQVLL    281 - 350
SGCRCVELDCWKGKPPDEEPIITHGFTMTTDIFFKEAIEAIAESAFKTSPYPIILSFENHVDSPRQQAKM    351 - 420
AEYCRTIFGDMLLTEPLEKFPLKPGVPLPSPEDLRGKILIKNKKNQFSGPTSSSKDTGGEAEGSSPPSAP    421 - 490
AGEGTVWAGEEGTELEEEEVEEEEEEESGNLDEEEIKKMQSDEGTAGLEVTAYEEMSSLVNYIQPTKFVS    491 - 560
FEFSAQKNRSYVISSFTELKAYDLLSKASVQFVDYNKRQMSRIYPKGTRMDSSNYMPQMFWNAGCQMVAL    561 - 630
NFQTMDLPMQQNMAVFEFNGQSGYLLKHEFMRRPDKQFNPFSVDRIDVVVATTLSITVISGQFLSERSVR    631 - 700
TYVEVELFGLPGDPKRRYRTKLSPSTNSINPVWKEEPFVFEKILMPELASLRVAVMEEGNKFLGHRIIPI    701 - 770
NALNSGYHHLCLHSESNMPLTMPALFIFLEMKDYIPGAWADLTVALANPIKFFSAHDTKSVKLKEAMGGL    771 - 840
PEKPFPLASPVASQVNGALAPTSNGSPAARAGAREEAMKEAAEPRTASLEELRELKGVVKLQRRHEKELR    841 - 910
ELERRGARRWEELLQRGAAQLAELGPPGVGGVGACKLGPGKGSRKKRSLPREESAGAAPGEGPEGVDGRV    911 - 980
RELKDRLELELLRQGEEQYECVLKRKEQHVAEQISKMMELAREKQAAELKALKETSENDTKEMKKKLETK    981 - 1050
RLERIQGMTKVTTDKMAQERLKREINNSHIQEVVQVIKQMTENLERHQEKLEEKQAACLEQIREMEKQFQ   1051 - 1120
KEALAEYEARMKGLEAEVKESVRACLRTCFPSEAKDKPERACECPPELCEQDPLIAKADAQESRL        1121 - 1185
//

Text Mined References (57)

PMID Year Title
26468229 2016 Gnb isoforms control a signaling pathway comprising Rac1, Plc?2, and Plc?3 leading to LFA-1 activation and neutrophil arrest in vivo.
25056061 2014 Biological insights from 108 schizophrenia-associated genetic loci.
24903829 2014 Neuropeptide Y reduces the expression of PLCB2, PLCD1 and selected PLC genes in cultured human endothelial cells.
24330829 2013 In triple negative breast tumor cells, PLC-?2 promotes the conversion of CD133high to CD133low phenotype and reduces the CD133-related invasiveness.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23690479 2013 Superantigen-induced steroid resistance depends on activation of phospholipase C?2.
23625927 2013 WDR26 functions as a scaffolding protein to promote G??-mediated phospholipase C ?2 (PLC?2) activation in leukocytes.
23006664 2013 PLC? isoforms differ in their subcellular location and their CT-domain dependent interaction with G?q.
22905097 2012 ?-Synuclein interacts with phospholipase C?2 to modulate G protein activation.
22728827 2012 GPCR activation of Ras and PI3Kc in neutrophils depends on PLCb2/b3 and the RasGEF RasGRP4.
More...