Property Summary

NCBI Gene PubMed Count 23
PubMed Score 93.52
PubTator Score 35.38

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (3)

Disease log2 FC p
acute quadriplegic myopathy -1.115 2.0e-05
lung cancer 1.800 1.4e-04
ovarian cancer 2.300 3.1e-05

Synonym

Accession Q00688 B2R4Q9 Q14317 PPIase FKBP3
Symbols FKBP-3
FKBP25
PPIase
FKBP-25

Gene

PDB

1PBK   2KFV   2MPH   5D75   5GPG  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (8)

AA Sequence

MAAAVPQRAWTVEQLRSEQLPKKDIIKFLQEHGSDSFLAEHKLLGNIKNVAKTANKDHLVTAYNHLFETK      1 - 70
RFKGTESISKVSEQVKNVKLNEDKPKETKSEETLDEGPPKYTKSVLKKGDKTNFPKKGDVVHCWYTGTLQ     71 - 140
DGTVFDTNIQTSAKKKKNAKPLSFKVGVGKVIRGWDEALLTMSKGEKARLEIEPEWAYGKKGQPDAKIPP    141 - 210
NAKLTFEVELVDID                                                            211 - 224
//

Text Mined References (34)

PMID Year Title