Property Summary

NCBI Gene PubMed Count 22
Grant Count 6
Funding $284,468.8
PubMed Score 84.61
PubTator Score 35.38

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
acute quadriplegic myopathy -1.115 0.000
lung cancer 1.800 0.000
ovarian cancer 2.300 0.000

Synonym

Accession Q00688 B2R4Q9 Q14317 PPIase FKBP3
Symbols FKBP-3
FKBP25
PPIase
FKBP-25

Gene

PANTHER Protein Class (1)

PDB

1PBK   2KFV   2MPH   5D75  

Gene RIF (7)

PMID Text
26762975 Structural basis for nucleic acid recognition by FKBP25 has been uncovered.
24998444 proteomics study indicates that the nuclear pool of the FKBP25 targets various nuclear proteins that are crucial for packaging of DNA, chromatin remodeling and pre-mRNA splicing
24840943 FKBP25 is likely recruited to preribosomes to chaperone one of the protein components of the ribosome large subunit.
24667607 structure of a unique N-terminal domain motif in the FKBP family, FKBP25(1-73), high-resolution structures show a new fold composed of five small helices where H3 and H4 are tilted in a novel arrangement; called Basic Tilted Helix Bundle (BTHB) domain.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19166840 FKBP3, a novel regulator of the p53 pathway, induces the degradation of MDM2 and activation of p53.

AA Sequence

MAAAVPQRAWTVEQLRSEQLPKKDIIKFLQEHGSDSFLAEHKLLGNIKNVAKTANKDHLVTAYNHLFETK      1 - 70
RFKGTESISKVSEQVKNVKLNEDKPKETKSEETLDEGPPKYTKSVLKKGDKTNFPKKGDVVHCWYTGTLQ     71 - 140
DGTVFDTNIQTSAKKKKNAKPLSFKVGVGKVIRGWDEALLTMSKGEKARLEIEPEWAYGKKGQPDAKIPP    141 - 210
NAKLTFEVELVDID                                                            211 - 224
//

Text Mined References (33)

PMID Year Title
26762975 2016 Structural basis of nucleic acid recognition by FK506-binding protein 25 (FKBP25), a nuclear immunophilin.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24998444 2014 Rapamycin-binding FKBP25 associates with diverse proteins that form large intracellular entities.
24840943 2014 The prolyl isomerase, FKBP25, interacts with RNA-engaged nucleolin and the pre-60S ribosomal subunit.
24667607 2014 Basic Tilted Helix Bundle - a new protein fold in human FKBP25/FKBP3 and HectD1.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
21812934 2011 Identification of candidate substrates for poly(ADP-ribose) polymerase-2 (PARP2) in the absence of DNA damage using high-density protein microarrays.
More...