Property Summary

NCBI Gene PubMed Count 218
PubMed Score 180.02
PubTator Score 966.22

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
Rheumatoid Arthritis -1.100 3.4e-02
osteosarcoma -1.829 1.6e-06
Atopic dermatitis 1.100 7.9e-05
tuberculosis -1.300 2.0e-07
pancreatic ductal adenocarcinoma liver m... 1.029 2.3e-02
lung cancer -1.400 3.0e-03

Gene RIF (166)

PMID Text
26455434 HDAC4-RelB-p52 complex maintains repressive chromatin around proapoptotic genes Bim and BMF and regulates multiple myeloma survival and growth
26389665 Data show that NF-kappa-B p52 subunit (p52) interacts with ets transcription factors ETS1/2 factors at the C250T telomerase (TERT) promoter to mediate TERT reactivation.
26307012 results suggest that glucocorticoids induce a transcription complex consisting of RelB/p52, CBP, and HDAC1 that triggers a dynamic acetylation-mediated epigenetic change to induce CRH expression in full-term human placenta.
26269414 we observed an association of FBW7 with p105 and p65, as well as p100, and knockdown of FBW7 eliminated 1,25D-dependent subunit turnover.
26067154 DLX4 induces CD44 by stimulating IL-1beta-mediated NF-kappaB activity, thereby promoting peritoneal metastasis of ovarian cancer
26056150 NF-kappaB2/p52:c-Myc:hnRNPA1 Pathway Regulates Expression of Androgen Receptor Splice Variants and Enzalutamide Sensitivity in Prostate Cancer
25901949 The augmentation of methylation in the NFkB2 promoter by interval walking training is advantageous in promoting a healthy state by ameliorating the susceptibility to inflammation
25524009 Results confirm previous findings that de novo mutations near the C-terminus of NFKB2 cause combined endocrine and immunodeficiencies.
25482563 The generation of p50 and p52 from their precursors depends on functional VCP/p97.
25349408 The unique ability of p100/IkappaBdelta to stably interact with all NF-kappaB subunits by forming kappaBsomes demonstrates its importance in sequestering NF-kappaB subunits and releasing them as dictated by specific stimuli for developmental programs.
25237204 We report 3 related individuals with a novel form of severe B-cell deficiency associated with partial persistence of serum immunoglobulin arising from a missense mutation in NFKB2.
25225662 NFkappaB2/p100 was overexpressed and accumulated in a well-established in vitro human monocyte model of Endotoxin tolerance. The p100 accumulation in these cells inversely correlated with the inflammatory response after LPS stimulation.
24888602 mutation results in common variable immunodeficiency with reduction in B cells, memory B cells and T follicular helper cells
24533079 NIK plays a key role in constitutive NF-kappaB activation and the progression of ovarian cancer cells
24355259 higher level of expression is associated with death in non-small cell lung cancer
24242887 NF-kappaB2/p100 deficiency caused a predominant B-cell-intrinsic TI-2 defect that could largely be attributed to impaired proliferation of plasmablasts. Importantly, p100 was also necessary for efficient defense against clinically relevant TI-2 pathogens.
24140114 Heterozygous mutations in NFKB2 cause a unique form of early-onset CVID that also presents with central adrenal insufficiency.
24012192 NFKB2 genetic variation associated with sleep disorders in patients, diagnosed with breast cancer.
23974100 NFKB2 binds to the PLK4 promoter at upstream and downstream of the PLK4 transcription initiation site abd reduced PLK4 mRNA and protein levels.
23873932 Sp1 is required for IL-15 induction by both poly(I:C) and respiratory syncytial virus, a response that also requires NFkappaB2 and IKKepsilon.
23699654 our study demonstrates a link between persistent activation of the AR by NF-kappaB2/p52 and development of resistance to enzalutamide in prostate cancer.
23453579 HIV-1 Vpr stimulates non-canonical NFKappaB pathway by inducing the phosphorylation of NFKappaB2 (p100) at serine 866, which leads to process p100 into RelB/p52 and its subsequent nuclear translocation
23389097 Single nucleotide polymorphisms of angiotensin-converting enzyme (ACE), nuclear factor kappa B (NFkB)and cholesteryl ester transport protein (CETP) were evaluated in nonagenarians, centenarians, and average life span individuals (controls).
23301098 TRAF2/NIK/NF-kappaB2 pathway regulates pancreatic ductal adenocarcinoma cell tumorigenicity
23219896 NF-kappaB is a crucial mediator involved in the pathogenesis of psoriasis.
23211527 the FBXW7alpha-dependent degradation of p100 functions as a prosurvival mechanism through control of NF-kappaB activity.
22879398 The noncanonical NF-kappaB pathway is integral in controlling immunoregulatory phenotypes of both plasmacytoid and conventional dendritic cells.
22864569 Fbw7-mediated destruction of p100 is a regulatory component restricting the response to NF-kappaB2 pathway stimulation.
22734038 RelB/NF-kappaB2, is constitutively activated in the human placenta, which binds to a previously undescribed NF-kappaB enhancer of corticotropin-releasing hormone (CRH) gene promoter to regulate CRH expression.
22642622 These findings provide a mouse model for human multiple myeloma with aberrant NF-kappaB2 activation and suggest a molecular mechanism for NF-kappaB2 signaling in the pathogenesis of plasma cell tumors.
22341466 HIV-1 Vpr stimulates non-canonical NFKappaB pathway by inducing the phosphorylation of NFKappaB2 (p100) at serine 866, which leads to process p100 into RelB/p52 and its subsequent nuclear translocation
22198284 mutant p53 elevates expression of genes capable of enhancing cell proliferation, motility, and tumorigenicity by inducing acetylation of histones via recruitment of CBP and STAT2 on the promoters causing CBP-mediated histone acetylation
22096027 Flt3ITD promotes a noncanonical pathway via TAK1 and p52NF-kappaB to suppress DAPK1 in association with histone deacetylases, which explains DAPK1 repression in Flt3ITD(+) acute myeloid leukemia.
22083306 NF-kappaB2 exhibits the major inhibitory role in the transcription at the CD99 promoter
21871426 The activation profile of diffuse large B-cell lymphomas/posttransplantation lymphoproliferative disorders was not associated with BAFF/BAFF-R expression, whereas nuclear p52 activation might be linked to Epstein-Barr virus.
21846842 Total expression of nuclear factor kappa B-2 was not significantly changed in melphalan resistance in multiple myeloma, but more of the protein population was converted into the p52 isoform
21228035 Data show that IKBalpha, NFKB2, and TRAF3 gene polymorphisms play a role in the development of multiple myeloma and in the response to bortezomib therapy.
21048223 Data show that MEKK-1 plays an integral role in IL-1beta modulation of Caco-2 TJ barrier function by regulating the activation of the canonical NF-kappaB pathway and the MLCK gene.
20734064 Observational study of gene-disease association. (HuGE Navigator)
20708837 Role of NFKB2 on the early myeloid differentiation of CD34+ hematopoietic stem/progenitor cells
20628624 Meta-analysis of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20598117 Nfkb2 is suppressed by c-Myc and harnesses Myc-driven lymphomagenesis.
20568250 Observational study of gene-disease association. (HuGE Navigator)
20503287 Observational study of gene-disease association. (HuGE Navigator)
20448286 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20388792 NF-kappaB2/p52 may play a critical role in the progression of castration-resistant prostate cancer through activation of the androgen receptor
20353939 the Tio oncoprotein triggers noncanonical NF-kappaB signaling through NEMO-dependent up-regulation of p100 precursor and RelB, as well as through NEMO-independent generation of p52 effector
20346360 Observational study of gene-disease association. (HuGE Navigator)
20038584 Data demonstrate in various tumor cell lines and primary T-cells that TNFR2, but not TNFR1, induces activation of the alternative NFkappaB pathway and p100 processing.
20037209 Observational study of gene-disease association. (HuGE Navigator)
19948975 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and genetic testing. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19860880 Human intron enhancer kappa (iE kappa) is active in Ig kappa-expressing nasopharyngeal carcinoma cells and LMP1-stimulated NF-kappaB and AP-1 activation results in an augmenting activation of the iE kappa.
19773279 Observational study of gene-disease association. (HuGE Navigator)
19591173 Extracellular domain of RAGE down-regulates RAGE expression and inhibits p65 and p52 activation in human-salivary gland-cell-lines.
19573080 Observational study of gene-disease association. (HuGE Navigator)
19527514 Observational study of gene-disease association. (HuGE Navigator)
19524538 Nfkb1 and Nfkb2 assemble into high-molecular-weight complex that contributes to the regulation of all NF-kappaB isoforms.
19479051 HIV-1 Vpr stimulates non-canonical NFKappaB pathway by inducing the phosphorylation of NFKappaB2 (p100) at serine 866, which leads to process p100 into RelB/p52 and its subsequent nuclear translocation
19258923 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19219072 A molecular mechanism by which the recruitment of a H3K4 histone methyltransferase complex on the promoter of a NF-kappaB-dependent gene induces its expression.
19098713 The X-ray structure of the nuclear factor-kappaB p52:RelB:kappaB DNA complex reveals a new recognition feature not previously seen in other NF-kappaB:kappaB DNA complexes. Arg 125 of RelB is in contact with an additional DNA base pair.
18971284 HIV-1 Vpr stimulates non-canonical NFKappaB pathway by inducing the phosphorylation of NFKappaB2 (p100) at serine 866, which leads to process p100 into RelB/p52 and its subsequent nuclear translocation
18818748 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18781579 Overexpression of NF-kappaB2/p52 protects androgen sensitive human prostate cancer cells from apoptotic cell death and cell cycle arrest induced by androgen-deprivation.
18660489 Observational study of gene-disease association. (HuGE Navigator)
18550535 RIG-1 - MAVS interacts with cytoplasmic 100-kDa NF-kappa B2 complexes via a novel retinoic acid-inducible gene-I - NF- kappa B-inducing kinase signaling pathway
18538010 HIV-1 Vpr stimulates non-canonical NFKappaB pathway by inducing the phosphorylation of NFKappaB2 (p100) at serine 866, which leads to process p100 into RelB/p52 and its subsequent nuclear translocation
18466468 Observational study of gene-disease association. (HuGE Navigator)
18434448 Observational study of gene-disease association. (HuGE Navigator)
18383001 NFkappaB2 gene duplication is associated with fetal pyelectasis in partial trisomy 10q (10q24.1 --> qter).
18377428 NF-kappaB2 gene rearrangement may be a factor in the constitutive activation of NF-kappaB in ATL, and thereby playing a role in the ATL pathogenesis.
18321863 These unique protein-protein contacts explain why RelB prefers p52 as its dimeric partner for transcriptional activity and is retained in the cytoplasm as an inhibited complex by p100.
18160848 HIV-1 Vpr stimulates non-canonical NFKappaB pathway by inducing the phosphorylation of NFKappaB2 (p100) at serine 866, which leads to process p100 into RelB/p52 and its subsequent nuclear translocation
18025803 demonstrated that human hepatocellular carcinomas almost universally overexpress Bcl-3 and preferentially express nuclear p52 and p50, with little evidence of p65 activation
18025196 The findings demonstrate a key role for NF-kappaB2 in the regulation of RelA activation and suggest overlap in the function of NF-kappaB members in canonical and noncanonical pathway signaling.
17715223 activation of NF-kappaB2/p100 plays a crucial role in the Tax1-mediated transformation of T cells
17703412 Observational study of gene-disease association. (HuGE Navigator)
17548614 NF-kappaB2/p100 acts as a late-acting negative-feedback signaling molecule in the TCR-mediated NF-kappaB pathway.
17476277 cell adhesion-mediated proteolysis of the NF-kappaB precursor, p100 (NF-kappaB2) resulted in the generation of active p52, which translocated to the nucleus in complex with p65 and RelB
17363471 C-terminally truncated NF-kappaB2 precursors are endoproteolytically processed at kappaB-containing promoters
17292587 Study reports that androgenic stimulation of LNCaP cells with the androgen analogue R1881 appears to positively regulate the non-canonical NF-kappaB pathway as p52 accumulates both in the cytoplasm and nucleus after 48-72 h of stimulation.
17237370 Monarch-1 inhibits CD40-mediated activation of NFKB and processing of NFKB2 to p52. This inhibition stems from the ability of Monarch-1 to associate with and induce proteasome-mediated degradation of NF-kappaB inducing kinase.
17197385 HIV-1 Vpr stimulates non-canonical NFKappaB pathway by inducing the phosphorylation of NFKappaB2 (p100) at serine 866, which leads to process p100 into RelB/p52 and its subsequent nuclear translocation
17028057 We herein report that STP-A11 activates non-canonical NF-kappaB pathway, resulting in p100 processing to p52.
17003035 Novel interactions reveal of IKKepsilon in the regulation of the alternative NF-kappaB activation pathway involving p52 and p65 are reported.
16990795 p52 can regulate p53 function and influence p53-regulated decision-making following DNA damage and oncogene activation.
16940298 HBx and NF-kappaB2/BCL3 mediated-cyclin D1 up-regulation might play an important role in the HBx-mediated HCC development and progression
16751281 Data demonstrate an important role of NF-kappaB-1 and -2 pathways in mediating resistance to apoptosis and distinctive antiapoptotic downstream target gene profiles responsible for this effect.
16651533 Stat3-mediated p100 processing to p52 requires activation of Stat3 by the acetyltransferase activity of cAMP-response element-binding protein (CREB)-binding protein (CBP)/p300
16385451 Observational study of gene-disease association. (HuGE Navigator)
16303288 These data suggest that p100 processing involves its phosphorylation at specific terminal serines, which form a binding site for beta-TrCP thereby regulating p100 ubiquitination.
16260623 mutants of p53 may induce loss of drug sensitivity is via the NF-kappaB2 pathway
16223731 studies define one important mechanism of NF-kappaB-inducing kinase (NIK) regulation and the central role of NIK stabilization in the induction of NF-kappaB2 precursor protein p100 processing
16108830 (p52)2/Bcl-3P ternary complex, which is specifically induced in CD30-stimulated anaplastic large cell lymphoma, can modulate expression of apoptosis-related genes regulated by NF-kappaB.
15782119 Enhanced expression of NF-kappaB2/p52 and RelB-containing NF-kappaB DNA-binding activity in Epstein-Barr virus-negative Reed Sternberg cells.
15677466 IkappaB kinase alpha has an essential role in the constitutive processing of NF-kappaB2 p100
15485830 the mechanism by which the different sequences within p100 work in concert to regulate its processing
15310758 beta-transducin repeat-containing protein-dependent and -independent mechanisms contribute to Tax-deregulated p100 processing
15258149 HIV-1 Vpr stimulates non-canonical NFKappaB pathway by inducing the phosphorylation of NFKappaB2 (p100) at serine 866, which leads to process p100 into RelB/p52 and its subsequent nuclear translocation
15140882 Induction of p100 processing by NF-kappaB-inducing kinase involves docking IkappaB kinase alpha (IKKalpha) to p100 and IKKalpha-mediated phosphorylation
15103018 HIV-1 Vpr stimulates non-canonical NFKappaB pathway by inducing the phosphorylation of NFKappaB2 (p100) at serine 866, which leads to process p100 into RelB/p52 and its subsequent nuclear translocation
14676825 The mechanism of processing of the NFKB2 precursor is regulated by a unique pathway.
14532284 LMP1 activation of these two NF-kappa B pathways, NFKB2 and I kappa B alpha, is shown here to require distinct regions of the LMP1 C-terminal cytoplasmic tail.
12927781 p100HB is a new mutant form of p100/NF-kappa B2 associated with deregulated NF-kappa B/Rel functions
12894228 Constitutive processing of C-terminal truncation mutants of p100 is associated with their active nuclear translocation. Mutation of the nuclear localization signal (NLS) of p100 abolishes its processing.
12874295 RelB has an effect on p100 processing, which is possibly regulated in a signal-dependent manner
12835724 p50 and p52 homodimers can transactivate the bcl-2 promoter through association with Bcl-3; in breast cancer and leukemic cells (CLL), high NF-kappaB2/p100 expression was associated with high Bcl-2 expression
12808109 p52 NF-kappaB subunit associates with histone deacetylase 1 when p53 represses cyclin D1 transcription through down regulation of Bcl-3
12524526 LT-beta receptor agonists and LPS induce NF-kappaB/p100 processing to p52 at the level of the ribosome.
12485413 HIV-1 Vpr stimulates non-canonical NFKappaB pathway by inducing the phosphorylation of NFKappaB2 (p100) at serine 866, which leads to process p100 into RelB/p52 and its subsequent nuclear translocation
12482669 HIV-1 Vpr stimulates non-canonical NFKappaB pathway by inducing the phosphorylation of NFKappaB2 (p100) at serine 866, which leads to process p100 into RelB/p52 and its subsequent nuclear translocation
12473373 HIV-1 Vpr stimulates non-canonical NFKappaB pathway by inducing the phosphorylation of NFKappaB2 (p100) at serine 866, which leads to process p100 into RelB/p52 and its subsequent nuclear translocation
12427593 HIV-1 Vpr stimulates non-canonical NFKappaB pathway by inducing the phosphorylation of NFKappaB2 (p100) at serine 866, which leads to process p100 into RelB/p52 and its subsequent nuclear translocation
12389034 NF-kappa B2 p100 has I kappa B-independent apoptotic activity and a unique tumour suppressor role
12352969 BAFF-induced NEMO-independent processing of NF-kappa B2 in maturing B cells
12185077 interaction with S9 19S proteasome subunit
12167619 HIV-1 Vpr stimulates non-canonical NFKappaB pathway by inducing the phosphorylation of NFKappaB2 (p100) at serine 866, which leads to process p100 into RelB/p52 and its subsequent nuclear translocation
11994270 Genetic evidence for the essential role of beta-transducin repeat-containing protein in the inducible processing of NF-kappa B2/p100
11833470 HIV-1 Vpr stimulates non-canonical NFKappaB pathway by inducing the phosphorylation of NFKappaB2 (p100) at serine 866, which leads to process p100 into RelB/p52 and its subsequent nuclear translocation
11827962 HIV-1 Vpr stimulates non-canonical NFKappaB pathway by inducing the phosphorylation of NFKappaB2 (p100) at serine 866, which leads to process p100 into RelB/p52 and its subsequent nuclear translocation
11704662 HIV-1 Vpr stimulates non-canonical NFKappaB pathway by inducing the phosphorylation of NFKappaB2 (p100) at serine 866, which leads to process p100 into RelB/p52 and its subsequent nuclear translocation
11579140 HIV-1 Vpr stimulates non-canonical NFKappaB pathway by inducing the phosphorylation of NFKappaB2 (p100) at serine 866, which leads to process p100 into RelB/p52 and its subsequent nuclear translocation
11522182 HIV-1 Vpr stimulates non-canonical NFKappaB pathway by inducing the phosphorylation of NFKappaB2 (p100) at serine 866, which leads to process p100 into RelB/p52 and its subsequent nuclear translocation
11511100 HIV-1 Vpr stimulates non-canonical NFKappaB pathway by inducing the phosphorylation of NFKappaB2 (p100) at serine 866, which leads to process p100 into RelB/p52 and its subsequent nuclear translocation
11385624 HIV-1 Vpr stimulates non-canonical NFKappaB pathway by inducing the phosphorylation of NFKappaB2 (p100) at serine 866, which leads to process p100 into RelB/p52 and its subsequent nuclear translocation
11299302 HIV-1 Vpr stimulates non-canonical NFKappaB pathway by inducing the phosphorylation of NFKappaB2 (p100) at serine 866, which leads to process p100 into RelB/p52 and its subsequent nuclear translocation
11241736 HIV-1 Vpr stimulates non-canonical NFKappaB pathway by inducing the phosphorylation of NFKappaB2 (p100) at serine 866, which leads to process p100 into RelB/p52 and its subsequent nuclear translocation
11160671 HIV-1 Vpr stimulates non-canonical NFKappaB pathway by inducing the phosphorylation of NFKappaB2 (p100) at serine 866, which leads to process p100 into RelB/p52 and its subsequent nuclear translocation
11044099 HIV-1 Vpr stimulates non-canonical NFKappaB pathway by inducing the phosphorylation of NFKappaB2 (p100) at serine 866, which leads to process p100 into RelB/p52 and its subsequent nuclear translocation
10799874 HIV-1 Vpr stimulates non-canonical NFKappaB pathway by inducing the phosphorylation of NFKappaB2 (p100) at serine 866, which leads to process p100 into RelB/p52 and its subsequent nuclear translocation
10671224 HIV-1 Vpr stimulates non-canonical NFKappaB pathway by inducing the phosphorylation of NFKappaB2 (p100) at serine 866, which leads to process p100 into RelB/p52 and its subsequent nuclear translocation
10644726 HIV-1 Vpr stimulates non-canonical NFKappaB pathway by inducing the phosphorylation of NFKappaB2 (p100) at serine 866, which leads to process p100 into RelB/p52 and its subsequent nuclear translocation
10644332 HIV-1 Vpr stimulates non-canonical NFKappaB pathway by inducing the phosphorylation of NFKappaB2 (p100) at serine 866, which leads to process p100 into RelB/p52 and its subsequent nuclear translocation
10580107 HIV-1 Vpr stimulates non-canonical NFKappaB pathway by inducing the phosphorylation of NFKappaB2 (p100) at serine 866, which leads to process p100 into RelB/p52 and its subsequent nuclear translocation
10480634 HIV-1 Vpr stimulates non-canonical NFKappaB pathway by inducing the phosphorylation of NFKappaB2 (p100) at serine 866, which leads to process p100 into RelB/p52 and its subsequent nuclear translocation
10446807 HIV-1 Vpr stimulates non-canonical NFKappaB pathway by inducing the phosphorylation of NFKappaB2 (p100) at serine 866, which leads to process p100 into RelB/p52 and its subsequent nuclear translocation
10400814 HIV-1 Vpr stimulates non-canonical NFKappaB pathway by inducing the phosphorylation of NFKappaB2 (p100) at serine 866, which leads to process p100 into RelB/p52 and its subsequent nuclear translocation
10393859 HIV-1 Vpr stimulates non-canonical NFKappaB pathway by inducing the phosphorylation of NFKappaB2 (p100) at serine 866, which leads to process p100 into RelB/p52 and its subsequent nuclear translocation
10384093 HIV-1 Vpr stimulates non-canonical NFKappaB pathway by inducing the phosphorylation of NFKappaB2 (p100) at serine 866, which leads to process p100 into RelB/p52 and its subsequent nuclear translocation
10225209 HIV-1 Vpr stimulates non-canonical NFKappaB pathway by inducing the phosphorylation of NFKappaB2 (p100) at serine 866, which leads to process p100 into RelB/p52 and its subsequent nuclear translocation
10207088 HIV-1 Vpr stimulates non-canonical NFKappaB pathway by inducing the phosphorylation of NFKappaB2 (p100) at serine 866, which leads to process p100 into RelB/p52 and its subsequent nuclear translocation
9792375 HIV-1 Vpr stimulates non-canonical NFKappaB pathway by inducing the phosphorylation of NFKappaB2 (p100) at serine 866, which leads to process p100 into RelB/p52 and its subsequent nuclear translocation
9730685 HIV-1 Vpr stimulates non-canonical NFKappaB pathway by inducing the phosphorylation of NFKappaB2 (p100) at serine 866, which leads to process p100 into RelB/p52 and its subsequent nuclear translocation
9566873 HIV-1 Vpr stimulates non-canonical NFKappaB pathway by inducing the phosphorylation of NFKappaB2 (p100) at serine 866, which leads to process p100 into RelB/p52 and its subsequent nuclear translocation
9525916 HIV-1 Vpr stimulates non-canonical NFKappaB pathway by inducing the phosphorylation of NFKappaB2 (p100) at serine 866, which leads to process p100 into RelB/p52 and its subsequent nuclear translocation
9510190 HIV-1 Vpr stimulates non-canonical NFKappaB pathway by inducing the phosphorylation of NFKappaB2 (p100) at serine 866, which leads to process p100 into RelB/p52 and its subsequent nuclear translocation
9278385 HIV-1 Vpr stimulates non-canonical NFKappaB pathway by inducing the phosphorylation of NFKappaB2 (p100) at serine 866, which leads to process p100 into RelB/p52 and its subsequent nuclear translocation
9110146 HIV-1 Vpr stimulates non-canonical NFKappaB pathway by inducing the phosphorylation of NFKappaB2 (p100) at serine 866, which leads to process p100 into RelB/p52 and its subsequent nuclear translocation
8834464 HIV-1 Vpr stimulates non-canonical NFKappaB pathway by inducing the phosphorylation of NFKappaB2 (p100) at serine 866, which leads to process p100 into RelB/p52 and its subsequent nuclear translocation
8724035 HIV-1 Vpr stimulates non-canonical NFKappaB pathway by inducing the phosphorylation of NFKappaB2 (p100) at serine 866, which leads to process p100 into RelB/p52 and its subsequent nuclear translocation
8709193 HIV-1 Vpr stimulates non-canonical NFKappaB pathway by inducing the phosphorylation of NFKappaB2 (p100) at serine 866, which leads to process p100 into RelB/p52 and its subsequent nuclear translocation
8676466 HIV-1 Vpr stimulates non-canonical NFKappaB pathway by inducing the phosphorylation of NFKappaB2 (p100) at serine 866, which leads to process p100 into RelB/p52 and its subsequent nuclear translocation
8627654 HIV-1 Vpr stimulates non-canonical NFKappaB pathway by inducing the phosphorylation of NFKappaB2 (p100) at serine 866, which leads to process p100 into RelB/p52 and its subsequent nuclear translocation
8615004 HIV-1 Vpr stimulates non-canonical NFKappaB pathway by inducing the phosphorylation of NFKappaB2 (p100) at serine 866, which leads to process p100 into RelB/p52 and its subsequent nuclear translocation
8207793 HIV-1 Vpr stimulates non-canonical NFKappaB pathway by inducing the phosphorylation of NFKappaB2 (p100) at serine 866, which leads to process p100 into RelB/p52 and its subsequent nuclear translocation
8113688 HIV-1 Vpr stimulates non-canonical NFKappaB pathway by inducing the phosphorylation of NFKappaB2 (p100) at serine 866, which leads to process p100 into RelB/p52 and its subsequent nuclear translocation
7859743 HIV-1 Vpr stimulates non-canonical NFKappaB pathway by inducing the phosphorylation of NFKappaB2 (p100) at serine 866, which leads to process p100 into RelB/p52 and its subsequent nuclear translocation
7838536 HIV-1 Vpr stimulates non-canonical NFKappaB pathway by inducing the phosphorylation of NFKappaB2 (p100) at serine 866, which leads to process p100 into RelB/p52 and its subsequent nuclear translocation
7800480 HIV-1 Vpr stimulates non-canonical NFKappaB pathway by inducing the phosphorylation of NFKappaB2 (p100) at serine 866, which leads to process p100 into RelB/p52 and its subsequent nuclear translocation
7729429 HIV-1 Vpr stimulates non-canonical NFKappaB pathway by inducing the phosphorylation of NFKappaB2 (p100) at serine 866, which leads to process p100 into RelB/p52 and its subsequent nuclear translocation
7690421 HIV-1 Vpr stimulates non-canonical NFKappaB pathway by inducing the phosphorylation of NFKappaB2 (p100) at serine 866, which leads to process p100 into RelB/p52 and its subsequent nuclear translocation
7494249 HIV-1 Vpr stimulates non-canonical NFKappaB pathway by inducing the phosphorylation of NFKappaB2 (p100) at serine 866, which leads to process p100 into RelB/p52 and its subsequent nuclear translocation
1583734 HIV-1 Vpr stimulates non-canonical NFKappaB pathway by inducing the phosphorylation of NFKappaB2 (p100) at serine 866, which leads to process p100 into RelB/p52 and its subsequent nuclear translocation
1505523 HIV-1 Vpr stimulates non-canonical NFKappaB pathway by inducing the phosphorylation of NFKappaB2 (p100) at serine 866, which leads to process p100 into RelB/p52 and its subsequent nuclear translocation

AA Sequence

MESCYNPGLDGIIEYDDFKLNSSIVEPKEPAPETADGPYLVIVEQPKQRGFRFRYGCEGPSHGGLPGASS      1 - 70
EKGRKTYPTVKICNYEGPAKIEVDLVTHSDPPRAHAHSLVGKQCSELGICAVSVGPKDMTAQFNNLGVLH     71 - 140
VTKKNMMGTMIQKLQRQRLRSRPQGLTEAEQRELEQEAKELKKVMDLSIVRLRFSAFLRASDGSFSLPLK    141 - 210
PVISQPIHDSKSPGASNLKISRMDKTAGSVRGGDEVYLLCDKVQKDDIEVRFYEDDENGWQAFGDFSPTD    211 - 280
VHKQYAIVFRTPPYHKMKIERPVTVFLQLKRKRGGDVSDSKQFTYYPLVEDKEEVQRKRRKALPTFSQPF    281 - 350
GGGSHMGGGSGGAAGGYGGAGGGGSLGFFPSSLAYSPYQSGAGPMGCYPGGGGGAQMAATVPSRDSGEEA    351 - 420
AEPSAPSRTPQCEPQAPEMLQRAREYNARLFGLAQRSARALLDYGVTADARALLAGQRHLLTAQDENGDT    421 - 490
PLHLAIIHGQTSVIEQIVYVIHHAQDLGVVNLTNHLHQTPLHLAVITGQTSVVSFLLRVGADPALLDRHG    491 - 560
DSAMHLALRAGAGAPELLRALLQSGAPAVPQLLHMPDFEGLYPVHLAVRARSPECLDLLVDSGAEVEATE    561 - 630
RQGGRTALHLATEMEELGLVTHLVTKLRANVNARTFAGNTPLHLAAGLGYPTLTRLLLKAGADIHAENEE    631 - 700
PLCPLPSPPTSDSDSDSEGPEKDTRSSFRGHTPLDLTCSTKVKTLLLNAAQNTMEPPLTPPSPAGPGLSL    701 - 770
GDTALQNLEQLLDGPEAQGSWAELAERLGLRSLVDTYRQTTSPSGSLLRSYELAGGDLAGLLEALSDMGL    771 - 840
EEGVRLLRGPETRDKLPSTAEVKEDSAYGSQSVEQEAEKLGPPPEPPGGLCHGHPQPQVH              841 - 900
//

Text Mined References (224)

PMID Year Title
26455434 2015 Transcriptional repression by the HDAC4-RelB-p52 complex regulates multiple myeloma survival and growth.
26389665 2015 Non-canonical NF-?B signalling and ETS1/2 cooperatively drive C250T mutant TERT promoter activation.
26307012 2015 RelB/p52-mediated NF-?B signaling alters histone acetylation to increase the abundance of corticotropin-releasing hormone in human placenta.
26269414 2015 The hormone-bound vitamin D receptor enhances the FBW7-dependent turnover of NF-?B subunits.
26067154 2015 The homeoprotein DLX4 stimulates NF-?B activation and CD44-mediated tumor-mesothelial cell interactions in ovarian cancer.
26056150 2015 NF-?B2/p52:c-Myc:hnRNPA1 Pathway Regulates Expression of Androgen Receptor Splice Variants and Enzalutamide Sensitivity in Prostate Cancer.
25901949 2015 NF?B2 Gene as a Novel Candidate that Epigenetically Responds to Interval Walking Training.
25852190 2015 Integrative analysis of kinase networks in TRAIL-induced apoptosis provides a source of potential targets for combination therapy.
25609649 2015 Proteomic analyses reveal distinct chromatin-associated and soluble transcription factor complexes.
25524009 2014 Mutations in NFKB2 and potential genetic heterogeneity in patients with DAVID syndrome, having variable endocrine and immune deficiencies.
25482563 2014 Quantitative dissection and modeling of the NF-?B p100-p105 module reveals interdependent precursor proteolysis.
25349408 2014 p100/I?B? sequesters and inhibits NF-?B through kappaBsome formation.
25237204 2014 Autosomal-dominant B-cell deficiency with alopecia due to a mutation in NFKB2 that results in nonprocessable p100.
25225662 2014 NF?B2/p100 is a key factor for endotoxin tolerance in human monocytes: a demonstration using primary human monocytes from patients with sepsis.
24888602 2014 Novel NFKB2 mutation in early-onset CVID.
24533079 2014 NF-?B inducing kinase, a central signaling component of the non-canonical pathway of NF-?B, contributes to ovarian cancer progression.
24355259 2014 NF-?B protein expression associates with (18)F-FDG PET tumor uptake in non-small cell lung cancer: a radiogenomics validation study to understand tumor metabolism.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24242887 2014 NF-?B2/p100 deficiency impairs immune responses to T-cell-independent type 2 antigens.
24140114 2013 Germline mutations in NFKB2 implicate the noncanonical NF-?B pathway in the pathogenesis of common variable immunodeficiency.
24012192 2014 Associations between cytokine gene variations and self-reported sleep disturbance in women following breast cancer surgery.
23974100 2013 NF?B regulates expression of Polo-like kinase 4.
23873932 2013 Nuclear factor ?B2 p52 protein has a role in antiviral immunity through I?B kinase epsilon-dependent induction of Sp1 protein and interleukin 15.
23699654 2013 NF-?B2/p52 induces resistance to enzalutamide in prostate cancer: role of androgen receptor and its variants.
23389097 2014 The frequency of 4 common gene polymorphisms in nonagenarians, centenarians, and average life span individuals.
23301098 2013 Downregulation of TRAF2 mediates NIK-induced pancreatic cancer cell proliferation and tumorigenicity.
23219896 2013 NF-?B: an essential transcription factor in psoriasis.
23211527 2012 SCF-mediated degradation of p100 (NF-?B2): mechanisms and relevance in multiple myeloma.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22879398 2012 Activation of the noncanonical NF-?B pathway by HIV controls a dendritic cell immunoregulatory phenotype.
22864569 2012 Proteomic screen reveals Fbw7 as a modulator of the NF-?B pathway.
22734038 2012 RelB/NF-?B2 regulates corticotropin-releasing hormone in the human placenta.
22708077 2012 SCF(Fbw7) modulates the NFkB signaling pathway by targeting NFkB2 for ubiquitination and destruction.
22642622 2012 NF-?B2 mutation targets survival, proliferation and differentiation pathways in the pathogenesis of plasma cell tumors.
22435556 2012 Dimer-specific regulatory mechanisms within the NF-?B family of transcription factors.
22198284 2012 p53 mutants induce transcription of NF-?B2 in H1299 cells through CBP and STAT binding on the NF-?B2 promoter and gain of function activity.
22096027 2012 A noncanonical Flt3ITD/NF-?B signaling pathway represses DAPK1 in acute myeloid leukemia.
22083306 2011 Nuclear factor-?B2 represses Sp1-mediated transcription at the CD99 promoter.
21988832 2011 Toward an understanding of the protein interaction network of the human liver.
21871426 2011 p52 Activation in monomorphic B-cell posttransplant lymphoproliferative disorder/diffuse large B-cell lymphoma without BAFF-R expression.
21846842 2011 Monitoring a nuclear factor-?B signature of drug resistance in multiple myeloma.
21269460 2011 Initial characterization of the human central proteome.
21228035 2011 Polymorphisms of nuclear factor-?B family genes are associated with development of multiple myeloma and treatment outcome in patients receiving bortezomib-based regimens.
21048223 2010 IL-1beta-induced increase in intestinal epithelial tight junction permeability is mediated by MEKK-1 activation of canonical NF-kappaB pathway.
20734064 2010 A large-scale candidate gene association study of age at menarche and age at natural menopause.
20708837 Role of NFKB2 on the early myeloid differentiation of CD34+ hematopoietic stem/progenitor cells.
20628624 2010 Evaluation of candidate stromal epithelial cross-talk genes identifies association between risk of serous ovarian cancer and TERT, a cancer susceptibility "hot-spot".
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20598117 2010 Myc suppression of Nfkb2 accelerates lymphomagenesis.
20568250 2010 Common single nucleotide polymorphisms in immunoregulatory genes and multiple myeloma risk among women in Connecticut.
20503287 2010 Interleukin-9 polymorphism in infants with respiratory syncytial virus infection: an opposite effect in boys and girls.
20448286 2010 Association between anti-tumour necrosis factor treatment response and genetic variants within the TLR and NF{kappa}B signalling pathways.
20388792 2010 Aberrant activation of the androgen receptor by NF-kappaB2/p52 in prostate cancer cells.
20353939 2010 Activation of noncanonical NF-kappaB signaling by the oncoprotein Tio.
20346360 2010 Genetic risk factors for hepatopulmonary syndrome in patients with advanced liver disease.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
20038584 2010 Membrane tumor necrosis factor (TNF) induces p100 processing via TNF receptor-2 (TNFR2).
20037209 2009 Genetic factors associated with rheumatoid arthritis and systemic vasculitis: Evaluation of a panel of polymorphisms.
19948975 2009 Integrative predictive model of coronary artery calcification in atherosclerosis.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19860880 2009 LMP1-augmented kappa intron enhancer activity contributes to upregulation expression of Ig kappa light chain via NF-kappaB and AP-1 pathways in nasopharyngeal carcinoma cells.
19773279 2009 Association between genetic variants in VEGF, ERCC3 and occupational benzene haematotoxicity.
19591173 2009 RAGE expression and NF-kappaB activation attenuated by extracellular domain of RAGE in human salivary gland cell line.
19573080 2009 Common genetic variants in candidate genes and risk of familial lymphoid malignancies.
19527514 2009 Racial disparity in pathophysiologic pathways of preterm birth based on genetic variants.
19524538 2009 The Nfkb1 and Nfkb2 proteins p105 and p100 function as the core of high-molecular-weight heterogeneous complexes.
19302050 2009 Regulation and function of NF-kappaB transcription factors in the immune system.
19258923 2009 Genetic susceptibility to respiratory syncytial virus bronchiolitis in preterm children is associated with airway remodeling genes and innate immune genes.
19219072 2009 Matrix Metalloproteinase-9 gene induction by a truncated oncogenic NF-kappaB2 protein involves the recruitment of MLL1 and MLL2 H3K4 histone methyltransferase complexes.
19098713 2009 NF-kappaB p52:RelB heterodimer recognizes two classes of kappaB sites with two distinct modes.
18818748 2008 Preterm birth in Caucasians is associated with coagulation and inflammation pathway gene variants.
18781579 2008 NF-kappaB2/p52 enhances androgen-independent growth of human LNCaP cells via protection from apoptotic cell death and cell cycle arrest induced by androgen-deprivation.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18660489 2008 Multiple genetic variants along candidate pathways influence plasma high-density lipoprotein cholesterol concentrations.
18617892 2008 SUMO1 modification of NF-kappaB2/p100 is essential for stimuli-induced p100 phosphorylation and processing.
18550535 2008 Respiratory syncytial virus induces RelA release from cytoplasmic 100-kDa NF-kappa B2 complexes via a novel retinoic acid-inducible gene-I{middle dot}NF- kappa B-inducing kinase signaling pathway.
18466468 2007 Analysis of variation in NF-kappaB genes and expression levels of NF-kappaB-regulated molecules.
18434448 2009 Genetic variation in the nuclear factor kappaB pathway in relation to susceptibility to rheumatoid arthritis.
18383001 2008 NFkappaB2 gene duplication is associated with fetal pyelectasis in partial trisomy 10q (10q24.1 --> qter).
18377428 2008 Rearranged NF-kappa B2 gene in an adult T-cell leukemia cell line.
18321863 2008 Stabilization of RelB requires multidomain interactions with p100/p52.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
18025803 2007 Expression of nuclear factor-kappaB family proteins in hepatocellular carcinomas.
18025196 2007 A novel mutation in the Nfkb2 gene generates an NF-kappa B2 "super repressor".
17715223 2007 Cooperation of NF-kappaB2/p100 activation and the PDZ domain binding motif signal in human T-cell leukemia virus type 1 (HTLV-1) Tax1 but not HTLV-2 Tax2 is crucial for interleukin-2-independent growth transformation of a T-cell line.
17703412 2007 Genetic susceptibility to respiratory syncytial virus bronchiolitis is predominantly associated with innate immune genes.
17548614 2007 Negative regulation of TCR signaling by NF-kappaB2/p100.
17476277 2007 Bone marrow stromal cells prevent apoptosis of lymphoma cells by upregulation of anti-apoptotic proteins associated with activation of NF-kappaB (RelB/p52) in non-Hodgkin's lymphoma cells.
17363471 2007 Endoproteolytic processing of C-terminally truncated NF-kappaB2 precursors at kappaB-containing promoters.
17292587 2007 NF-kappaB2 processing and p52 nuclear accumulation after androgenic stimulation of LNCaP prostate cancer cells.
17254973 2007 A fourth IkappaB protein within the NF-kappaB signaling module.
17237370 2007 Monarch-1 suppresses non-canonical NF-kappaB activation and p52-dependent chemokine expression in monocytes.
17039258 2006 NF-kappaB2 is required for the establishment of central tolerance through an Aire-dependent pathway.
17028057 2007 Activation of non-canonical NF-kappaB pathway mediated by STP-A11, an oncoprotein of Herpesvirus saimiri.
17003035 2006 IkappaB kinase epsilon interacts with p52 and promotes transactivation via p65.
16990795 2006 Regulation of p53 tumour suppressor target gene expression by the p52 NF-kappaB subunit.
16940298 2006 Up-regulation of cyclin D1 by HBx is mediated by NF-kappaB2/BCL3 complex through kappaB site of cyclin D1 promoter.
16751281 2006 The role of NF-{kappa}B-1 and NF-{kappa}B-2-mediated resistance to apoptosis in lymphomas.
16651533 2006 Stat3 activation of NF-{kappa}B p100 processing involves CBP/p300-mediated acetylation.
16613850 2006 Akt regulates basal and induced processing of NF-kappaB2 (p100) to p52.
16477006 2006 IL-1 receptor-associated kinase 1 is critical for latent membrane protein 1-induced p65/RelA serine 536 phosphorylation and NF-kappaB activation.
16385451 2006 A scan of chromosome 10 identifies a novel locus showing strong association with late-onset Alzheimer disease.
16368877 2006 Genomic annotation of 15,809 ESTs identified from pooled early gestation human eyes.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16303288 2006 beta-TrCP binding and processing of NF-kappaB2/p100 involve its phosphorylation at serines 866 and 870.
16260623 2005 Tumor-derived p53 mutants induce NF-kappaB2 gene expression.
16223731 2005 Stabilization of basally translated NF-kappaB-inducing kinase (NIK) protein functions as a molecular switch of processing of NF-kappaB2 p100.
16108830 2005 Stimulation of CD30 in anaplastic large cell lymphoma leads to production of nuclear factor-kappaB p52, which is associated with hyperphosphorylated Bcl-3.
15799966 2005 COMMD proteins, a novel family of structural and functional homologs of MURR1.
15782119 2005 Aberrant NF-kappaB2/p52 expression in Hodgkin/Reed-Sternberg cells and CD30-transformed rat fibroblasts.
15677466 2005 Essential role of IkappaB kinase alpha in the constitutive processing of NF-kappaB2 p100.
15677444 2005 NF-{kappa}B is transported into the nucleus by importin {alpha}3 and importin {alpha}4.
15629778 2005 High levels of p105 (NFKB1) and p100 (NFKB2) proteins in HPV16-transformed keratinocytes: role of E6 and E7 oncoproteins.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15485830 2005 Regulation of NF-kappa B2 p100 processing by its cis-acting domain.
15310758 2004 Tax deregulation of NF-kappaB2 p100 processing involves both beta-TrCP-dependent and -independent mechanisms.
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
15140882 2004 Induction of p100 processing by NF-kappaB-inducing kinase involves docking IkappaB kinase alpha (IKKalpha) to p100 and IKKalpha-mediated phosphorylation.
14743216 2004 A physical and functional map of the human TNF-alpha/NF-kappa B signal transduction pathway.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14676825 2004 Mechanism of processing of the NF-kappa B2 p100 precursor: identification of the specific polyubiquitin chain-anchoring lysine residue and analysis of the role of NEDD8-modification on the SCF(beta-TrCP) ubiquitin ligase.
14576817 2003 Epstein-Barr virus-encoded latent infection membrane protein 1 regulates the processing of p100 NF-kappaB2 to p52 via an IKKgamma/NEMO-independent signalling pathway.
14532284 2003 Latent membrane protein 1 of Epstein-Barr virus stimulates processing of NF-kappa B2 p100 to p52.
12927781 2003 Identification and characterization of p100HB, a new mutant form of p100/NF-kappa B2.
12894228 2003 Regulation of NF-kappaB2/p100 processing by its nuclear shuttling.
12874295 2003 Critical role of RelB serine 368 for dimerization and p100 stabilization.
12835724 2003 NF- kappa B2/p100 induces Bcl-2 expression.
12808109 2003 p53 represses cyclin D1 transcription through down regulation of Bcl-3 and inducing increased association of the p52 NF-kappaB subunit with histone deacetylase 1.
12697057 2003 Refined physical map of the human PAX2/HOX11/NFKB2 cancer gene region at 10q24 and relocalization of the HPV6AI1 viral integration site to 14q13.3-q21.1.
12524526 2003 Lymphotoxin and lipopolysaccharide induce NF-kappaB-p52 generation by a co-translational mechanism.
12505990 2003 RelB is required for Peyer's patch development: differential regulation of p52-RelB by lymphotoxin and TNF.
12485413 2003 HIV-Tat protein induces oxidative and inflammatory pathways in brain endothelium.
12482669 2002 Signaling pathways triggered by HIV-1 Tat in human monocytes to induce TNF-alpha.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12473373 2003 U50,488 inhibits HIV-1 Tat-induced monocyte chemoattractant protein-1 (CCL2) production by human astrocytes.
12427593 2002 Transfection of human endothelial cells with HIV-1 tat gene activates NF-kappa B and enhances monocyte adhesion.
12389034 2002 NF-kappa B2 p100 is a pro-apoptotic protein with anti-oncogenic function.
12352969 2002 BAFF-induced NEMO-independent processing of NF-kappa B2 in maturing B cells.
12351572 2002 The NF-kappaB signalling pathway in human diseases: from incontinentia pigmenti to ectodermal dysplasias and immune-deficiency syndromes.
12185077 2002 S9, a 19 S proteasome subunit interacting with ubiquitinated NF-kappaB2/p100.
12167619 2002 Human immunodeficiency virus type 1 (HIV-1) tat induces nitric-oxide synthase in human astroglia.
12040437 2002 Nuclear transcription factor-kappaB as a target for cancer drug development.
11994270 2002 Genetic evidence for the essential role of beta-transducin repeat-containing protein in the inducible processing of NF-kappa B2/p100.
11980335 2002 [The Rel/NF-kappa-B transcription factors: complex role in cell regulation].
11833470 2001 [HIV-1 Tat protein induces IL-10 production by human monocytes: implications of the PKC and calcium pathway].
11827962 2002 The human immunodeficiency virus-1 Tat protein activates human umbilical vein endothelial cell E-selectin expression via an NF-kappa B-dependent mechanism.
11707390 2001 Crystal structure of the ankyrin repeat domain of Bcl-3: a unique member of the IkappaB protein family.
11704662 2002 Nuclear receptor coactivator p160 proteins enhance the HIV-1 long terminal repeat promoter by bridging promoter-bound factors and the Tat-P-TEFb complex.
11579140 2001 Pro-inflammatory and pro-oxidant properties of the HIV protein Tat in a microglial cell line: attenuation by 17 beta-estradiol.
11526476 2001 The tumor suppressor protein menin interacts with NF-kappaB proteins and inhibits NF-kappaB-mediated transactivation.
11522182 2001 HIV type 1 Tat inhibits tumor necrosis factor alpha-induced repression of tumor necrosis factor receptor p55 and amplifies tumor necrosis factor alpha activity in stably tat-transfected HeLa Cells.
11511100 2001 Hiv-1 Tat can substantially enhance the capacity of NIK to induce IkappaB degradation.
11468175 2001 Modulation of T-cell activation by the glucocorticoid-induced leucine zipper factor via inhibition of nuclear factor kappaB.
11385624 2001 The effect of HIV-1 regulatory proteins on cellular genes: derepression of the IL-2 promoter by Tat.
11239468 2001 NF-kappaB-inducing kinase regulates the processing of NF-kappaB2 p100.
11044099 2000 Tat protein of human immunodeficiency virus type 1 induces interleukin-10 in human peripheral blood monocytes: implication of protein kinase C-dependent pathway.
10830747 2000 Normal structure of NFKB2, C-REL and BCL-3 gene loci in lymphoproliferative and myeloproliferative disorders.
10823818 2000 Characterization of the recombinant IKK1/IKK2 heterodimer. Mechanisms regulating kinase activity.
10799874 2000 Differential requirement for p56lck in HIV-tat versus TNF-induced cellular responses: effects on NF-kappa B, activator protein-1, c-Jun N-terminal kinase, and apoptosis.
10723127 2000 Activation of NF-kappa B by the dsRNA-dependent protein kinase, PKR involves the I kappa B kinase complex.
10713675 2000 Transcriptional regulatory effects of lymphoma-associated NFKB2/lyt10 protooncogenes.
10671224 2000 T cell activation-induced and HIV tat-enhanced CD95(APO-1/Fas) ligand transcription involves NF-kappaB.
10644726 2000 The nuclear receptor chicken ovalbumin upstream promoter transcription factor interacts with HIV-1 Tat and stimulates viral replication in human microglial cells.
10644332 2000 The human immunodeficiency virus type 1 Tat protein up-regulates the promoter activity of the beta-chemokine monocyte chemoattractant protein 1 in the human astrocytoma cell line U-87 MG: role of SP-1, AP-1, and NF-kappaB consensus sites.
10597218 1999 The generation of nfkb2 p52: mechanism and efficiency.
10580107 1999 Human immunodeficiency virus-1-tat induces matrix metalloproteinase-9 in monocytes through protein tyrosine phosphatase-mediated activation of nuclear transcription factor NF-kappaB.
10562553 1999 Constitutive silencing of IFN-beta promoter is mediated by NRF (NF-kappaB-repressing factor), a nuclear inhibitor of NF-kappaB.
10480634 1999 Extracellular HIV type 1 Tat protein induces CD69 expression through NF-kappaB activation: possible correlation with cell surface Tat-binding proteins.
10446807 1999 Human immunodeficiency virus type 1 Tat protein stimulates inducible nitric oxide synthase expression and nitric oxide production in microglial cultures.
10400814 1999 Human immunodeficiency virus type 1 tat protein activates transcription factor NF-kappaB through the cellular interferon-inducible, double-stranded RNA-dependent protein kinase, PKR.
10393859 1999 Nitric oxide inhibits HIV tat-induced NF-kappaB activation.
10384093 1999 Cutting edge: a short polypeptide domain of HIV-1-Tat protein mediates pathogenesis.
10225209 HIV-1 regulatory protein tat induces RNA binding proteins in central nervous system cells that associate with the viral trans-acting-response regulatory motif.
9895331 1999 New insights into the role of nuclear factor-kappaB, a ubiquitous transcription factor in the initiation of diseases.
9792375 1998 Purified Tat induces inflammatory response genes in Kaposi's sarcoma cells.
9730685 HIV-1 tat molecular diversity and induction of TNF-alpha: implications for HIV-induced neurological disease.
9566873 1998 Transcriptional activation of the integrated chromatin-associated human immunodeficiency virus type 1 promoter.
9529131 1998 Regulation of p100 (NFKB2) expression in human monocytes in response to inflammatory mediators and lymphokines.
9523851 1998 Interleukin-1 increases expression of the LYT-10 (NFkappaB2) proto-oncogene/transcription factor in renal cell carcinoma lines.
9510190 1998 Superinduction of IL-8 in T cells by HIV-1 Tat protein is mediated through NF-kappaB factors.
9407099 1997 Diverse effects of BCL3 phosphorylation on its modulation of NF-kappaB p52 homodimer binding to DNA.
9384586 1997 Structure of the human NF-kappaB p52 homodimer-DNA complex at 2.1 A resolution.
9359707 1997 Osteopetrosis in mice lacking NF-kappaB1 and NF-kappaB2.
9315679 1997 A new member of the I kappaB protein family, I kappaB epsilon, inhibits RelA (p65)-mediated NF-kappaB transcription.
9278385 1997 The Tat protein of HIV-1 induces tumor necrosis factor-alpha production. Implications for HIV-1-associated neurological diseases.
9264393 1997 Germline configuration of nfkb2, c-rel and bcl3 in childhood acute lymphoblastic leukemia (ALL).
9110146 1997 Iron chelation decreases human immunodeficiency virus-1 Tat potentiated tumor necrosis factor-induced NF-kappa B activation in Jurkat cells.
9021684 1996 The involvement of the candidate proto-oncogene NFKB2/lyt-10 in lymphoid malignancies.
8887665 1996 Differential regulation of NF-kappaB2(p100) processing and control by amino-terminal sequences.
8724035 1996 Enhanced nuclear factor-kappa B activation induced by tumour necrosis factor-alpha in stably tat-transfected cells is associated with the presence of cell-surface-bound Tat protein.
8717528 1996 The NF-kappa B and I kappa B proteins: new discoveries and insights.
8676466 1996 Activation of transcription factor NF-kappaB by the Tat protein of human immunodeficiency virus type 1.
8627654 1996 Extracellular human immunodeficiency virus type 1 Tat protein is associated with an increase in both NF-kappa B binding and protein kinase C activity in primary human astrocytes.
8615004 1996 Differential effects of I kappa B molecules on Tat-mediated transactivation of HIV-1 LTR.
8453667 1993 The oncoprotein Bcl-3 directly transactivates through kappa B motifs via association with DNA-binding p50B homodimers.
8441377 1993 Dimerization of NF-KB2 with RelA(p65) regulates DNA binding, transcriptional activation, and inhibition by an I kappa B-alpha (MAD-3).
8423996 1993 Chromosomal localization of genes encoding the transcription factors, c-rel, NF-kappa Bp50, NF-kappa Bp65, and lyt-10 by fluorescence in situ hybridization.
8413211 1993 NF-kappa B p100 (Lyt-10) is a component of H2TF1 and can function as an I kappa B-like molecule.
8378093 1993 Structural alterations of the NF-kappa B transcription factor lyt-10 in lymphoid malignancies.
8360178 1993 Purification of the major histocompatibility complex class I transcription factor H2TF1. The full-length product of the nfkb2 gene.
8336950 1993 NF-kappa B precursor p100 inhibits nuclear translocation and DNA binding of NF-kappa B/rel-factors.
8208540 1994 Rearranged NFKB2 gene in the HUT78 T-lymphoma cell line codes for a constitutively nuclear factor lacking transcriptional repressor functions.
8152812 1994 Activation of multiple NF-kappa B/Rel DNA-binding complexes by tumor necrosis factor.
8108136 1994 Mechanism of expression and role in transcriptional control of the proto-oncogene NFKB-2/LYT-10.
8108127 1994 Overproduction of NFKB2 (lyt-10) and c-Rel: a mechanism for HTLV-I Tax-mediated trans-activation via the NF-kappa B signalling pathway.
8036016 1994 Rearrangement and altered expression of the NFKB-2 gene in human cutaneous T-lymphoma cells.
7969113 1994 Transcriptional regulation of NF-kappa B2: evidence for kappa B-mediated positive and negative autoregulation.
7949142 1994 Heterogeneous chromosomal aberrations generate 3' truncations of the NFKB2/lyt-10 gene in lymphoid malignancies.
7925301 1994 Differential interactions of Rel-NF-kappa B complexes with I kappa B alpha determine pools of constitutive and inducible NF-kappa B activity.
7838536 1995 A CNS-enriched factor that binds to NF-kappa B and is required for interaction with HIV-1 tat.
7823959 1995 Characterization of mechanisms involved in transrepression of NF-kappa B by activated glucocorticoid receptors.
7800480 1994 Different members of the Sp1 multigene family exert opposite transcriptional regulation of the long terminal repeat of HIV-1.
7729429 1995 Absolute dependence on kappa B responsive elements for initiation and Tat-mediated amplification of HIV transcription in blood CD4 T lymphocytes.
7690421 1993 In vitro and in vivo binding of human immunodeficiency virus type 1 Tat protein and Sp1 transcription factor.
7597296 1995 bcl-1, bcl-2, p53, c-myc, and lyt-10 analysis in cutaneous lymphomas.
7541912 1995 Structural and functional characterization of the promoter regions of the NFKB2 gene.
7478612 1995 Highly-expressed p100/p52 (NFKB2) sequesters other NF-kappa B-related proteins in the cytoplasm of human breast cancer cells.
1876189 1991 Cloning of an NF-kappa B subunit which stimulates HIV transcription in synergy with p65.
1760839 1991 B cell lymphoma-associated chromosomal translocation involves candidate oncogene lyt-10, homologous to NF-kappa B p50.
1612589 1992 Related subunits of NF-kappa B map to two distinct loci associated with translocations in leukemia, NFKB1 and NFKB2.
1583734 1992 Specific NF-kappa B subunits act in concert with Tat to stimulate human immunodeficiency virus type 1 transcription.
1531086 1992 A novel mitogen-inducible gene product related to p50/p105-NF-kappa B participates in transactivation through a kappa B site.
1505523 1992 TAR-independent transactivation by Tat in cells derived from the CNS: a novel mechanism of HIV-1 gene regulation.
1473734 1992 Nuclear factor kappa B: an oxidative stress-responsive transcription factor of eukaryotic cells (a review).