Property Summary

NCBI Gene PubMed Count 218
Grant Count 51
R01 Count 36
Funding $3,399,107.61
PubMed Score 180.02
PubTator Score 966.22

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
Rheumatoid Arthritis -1.100 0.034
osteosarcoma -1.829 0.000
Atopic dermatitis 1.100 0.000
tuberculosis -1.300 0.000
pancreatic ductal adenocarcinoma liver m... 1.029 0.023
lung cancer -1.400 0.003

Gene RIF (171)

PMID Text
26455434 HDAC4-RelB-p52 complex maintains repressive chromatin around proapoptotic genes Bim and BMF and regulates multiple myeloma survival and growth
26389665 Data show that NF-kappa-B p52 subunit (p52) interacts with ets transcription factors ETS1/2 factors at the C250T telomerase (TERT) promoter to mediate TERT reactivation.
26307012 results suggest that glucocorticoids induce a transcription complex consisting of RelB/p52, CBP, and HDAC1 that triggers a dynamic acetylation-mediated epigenetic change to induce CRH expression in full-term human placenta.
26269414 we observed an association of FBW7 with p105 and p65, as well as p100, and knockdown of FBW7 eliminated 1,25D-dependent subunit turnover.
26067154 DLX4 induces CD44 by stimulating IL-1beta-mediated NF-kappaB activity, thereby promoting peritoneal metastasis of ovarian cancer
26056150 NF-kappaB2/p52:c-Myc:hnRNPA1 Pathway Regulates Expression of Androgen Receptor Splice Variants and Enzalutamide Sensitivity in Prostate Cancer
25901949 The augmentation of methylation in the NFkB2 promoter by interval walking training is advantageous in promoting a healthy state by ameliorating the susceptibility to inflammation
25524009 Results confirm previous findings that de novo mutations near the C-terminus of NFKB2 cause combined endocrine and immunodeficiencies.
25482563 The generation of p50 and p52 from their precursors depends on functional VCP/p97.
25349408 The unique ability of p100/IkappaBdelta to stably interact with all NF-kappaB subunits by forming kappaBsomes demonstrates its importance in sequestering NF-kappaB subunits and releasing them as dictated by specific stimuli for developmental programs.
More...

AA Sequence

MESCYNPGLDGIIEYDDFKLNSSIVEPKEPAPETADGPYLVIVEQPKQRGFRFRYGCEGPSHGGLPGASS      1 - 70
EKGRKTYPTVKICNYEGPAKIEVDLVTHSDPPRAHAHSLVGKQCSELGICAVSVGPKDMTAQFNNLGVLH     71 - 140
VTKKNMMGTMIQKLQRQRLRSRPQGLTEAEQRELEQEAKELKKVMDLSIVRLRFSAFLRASDGSFSLPLK    141 - 210
PVISQPIHDSKSPGASNLKISRMDKTAGSVRGGDEVYLLCDKVQKDDIEVRFYEDDENGWQAFGDFSPTD    211 - 280
VHKQYAIVFRTPPYHKMKIERPVTVFLQLKRKRGGDVSDSKQFTYYPLVEDKEEVQRKRRKALPTFSQPF    281 - 350
GGGSHMGGGSGGAAGGYGGAGGGGSLGFFPSSLAYSPYQSGAGPMGCYPGGGGGAQMAATVPSRDSGEEA    351 - 420
AEPSAPSRTPQCEPQAPEMLQRAREYNARLFGLAQRSARALLDYGVTADARALLAGQRHLLTAQDENGDT    421 - 490
PLHLAIIHGQTSVIEQIVYVIHHAQDLGVVNLTNHLHQTPLHLAVITGQTSVVSFLLRVGADPALLDRHG    491 - 560
DSAMHLALRAGAGAPELLRALLQSGAPAVPQLLHMPDFEGLYPVHLAVRARSPECLDLLVDSGAEVEATE    561 - 630
RQGGRTALHLATEMEELGLVTHLVTKLRANVNARTFAGNTPLHLAAGLGYPTLTRLLLKAGADIHAENEE    631 - 700
PLCPLPSPPTSDSDSDSEGPEKDTRSSFRGHTPLDLTCSTKVKTLLLNAAQNTMEPPLTPPSPAGPGLSL    701 - 770
GDTALQNLEQLLDGPEAQGSWAELAERLGLRSLVDTYRQTTSPSGSLLRSYELAGGDLAGLLEALSDMGL    771 - 840
EEGVRLLRGPETRDKLPSTAEVKEDSAYGSQSVEQEAEKLGPPPEPPGGLCHGHPQPQVH              841 - 900
//

Text Mined References (224)

PMID Year Title
26455434 2015 Transcriptional repression by the HDAC4-RelB-p52 complex regulates multiple myeloma survival and growth.
26389665 2015 Non-canonical NF-?B signalling and ETS1/2 cooperatively drive C250T mutant TERT promoter activation.
26307012 2015 RelB/p52-mediated NF-?B signaling alters histone acetylation to increase the abundance of corticotropin-releasing hormone in human placenta.
26269414 2015 The hormone-bound vitamin D receptor enhances the FBW7-dependent turnover of NF-?B subunits.
26067154 2015 The homeoprotein DLX4 stimulates NF-?B activation and CD44-mediated tumor-mesothelial cell interactions in ovarian cancer.
26056150 2015 NF-?B2/p52:c-Myc:hnRNPA1 Pathway Regulates Expression of Androgen Receptor Splice Variants and Enzalutamide Sensitivity in Prostate Cancer.
25901949 2015 NF?B2 Gene as a Novel Candidate that Epigenetically Responds to Interval Walking Training.
25852190 2015 Integrative analysis of kinase networks in TRAIL-induced apoptosis provides a source of potential targets for combination therapy.
25609649 2015 Proteomic analyses reveal distinct chromatin-associated and soluble transcription factor complexes.
25524009 2014 Mutations in NFKB2 and potential genetic heterogeneity in patients with DAVID syndrome, having variable endocrine and immune deficiencies.
More...