Property Summary

NCBI Gene PubMed Count 266
PubMed Score 216.96
PubTator Score 532.94

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
AMYOTROPHIC LATERAL SCLEROSIS 1 49 0.0 0.0
Neoplasms 63 0.0 0.0
Disease Target Count P-value
Breast cancer 3578 2.7e-04
medulloblastoma, large-cell 6241 9.2e-04
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Huntington's disease 76 3.415 1.7
Cancer 2499 3.254 1.6

Expression

  Differential Expression (2)

Disease log2 FC p
Breast cancer 1.100 2.7e-04
medulloblastoma, large-cell 1.200 9.2e-04

 GWAS Trait (1)

Protein-protein Interaction (1)

Gene RIF (209)

AA Sequence

MDLPVGPGAAGPSNVPAFLTKLWTLVSDPDTDALICWSPSGNSFHVFDQGQFAKEVLPKYFKHNNMASFV      1 - 70
RQLNMYGFRKVVHIEQGGLVKPERDDTEFQHPCFLRGQEQLLENIKRKVTSVSTLKSEDIKIRQDSVTKL     71 - 140
LTDVQLMKGKQECMDSKLLAMKHENEALWREVASLRQKHAQQQKVVNKLIQFLISLVQSNRILGVKRKIP    141 - 210
LMLNDSGSAHSMPKYSRQFSLEHVHGSGPYSAPSPAYSSSSLYAPDAVASSGPIISDITELAPASPMASP    211 - 280
GGSIDERPLSSSPLVRVKEEPPSPPQSPRVEEASPGRPSSVDTLLSPTALIDSILRESEPAPASVTALTD    281 - 350
ARGHTDTEGRPPSPPPTSTPEKCLSVACLDKNELSDHLDAMDSNLDNLQTMLSSHGFSVDTSALLDLFSP    351 - 420
SVTVPDMSLPDLDSSLASIQELLSPQEPPRPPEAENSSPDSGKQLVHYTAQPLFLLDPGSVDTGSNDLPV    421 - 490
LFELGEGSYFSEGDGFAEDPTISLLTGSEPPKAKDPTVS                                   491 - 529
//

Text Mined References (282)

PMID Year Title