Property Summary

NCBI Gene PubMed Count 234
PubMed Score 207.50
PubTator Score 532.94

Knowledge Summary


No data available


  Disease Sources (3)

Disease Target Count
Disease Target Count P-value
Breast cancer 3099 2.73650197394987E-4
medulloblastoma, large-cell 6234 9.2416748341335E-4
Disease Target Count Z-score Confidence
Huntington's disease 72 3.477 1.7
Cancer 2346 3.124 1.6


  Differential Expression (2)

Disease log2 FC p
medulloblastoma, large-cell 1.200 0.001
Breast cancer 1.100 0.000


Accession Q00613 A8K4L0 A8MW26 Q53XT4 HSF 1
Symbols HSTF1



2LDU   5D5U   5D5V  

  Ortholog (10)

Species Source
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG Inparanoid
Opossum OMA EggNOG
Platypus OMA EggNOG
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA Inparanoid

Gene RIF (187)

26785146 The authors found a temperature-dependent unfolding of Hsf1 in the regulatory region happening concomitant to tighter packing in the trimerization region.
26727489 The study presents cocrystal structures of the human HSF1 DNA-binding domain in complex with cognate DNA.
26511079 interaction of tumor cells and stromal fibroblasts increases the expression of HSF1 reciprocally in tumor microenvironment
26504030 High expression of HSF1 is associated with pancreatic cancer.
26503960 Aberrant HSF1 degradation is a key neurodegenerative mechanism underlying alpha-synucleinopathy. Elevated NEDD4 is implicated as the responsible ubiquitin E3 ligase for HSF1 degradation through ubiquitin-proteasome system.
26496226 oligomeric IER5 regulates PP2A activity and cell growth
26473447 High HSF1 expression is associated with acute myeloid leukemia.
26427350 Ginsenoside Rg3 induces FUT4-mediated apoptosis in H. pylori CagA-treated gastric cancer cells by regulating SP1 and HSF1 expressions
26361762 Phosphorylation of HSF1 at Ser230 is responsible for Hsp70-1 upregulation during coxsackieviral infection.
26359349 Data suggest that heat shock factor 1 (HSF1) interacts with both Ku autoantigens Ku70 and Ku86 to induce defective non-homologous end joining (NHEJ) repair activity and genomic instability.

AA Sequence

LFELGEGSYFSEGDGFAEDPTISLLTGSEPPKAKDPTVS                                   491 - 529

Text Mined References (245)

PMID Year Title
26785146 2016 Molecular mechanism of thermosensory function of human heat shock transcription factor Hsf1.
26727489 2016 Structure of human heat-shock transcription factor 1 in complex with DNA.
26511079 2015 Higher heat shock factor 1 expression in tumor stroma predicts poor prognosis in esophageal squamous cell carcinoma patients.
26504030 2015 Active Hexose-correlated Compound Down-regulates Heat Shock Factor 1, a Transcription Factor for HSP27, in Gemcitabine-resistant Human Pancreatic Cancer Cells.
26503960 2016 NEDD4-mediated HSF1 degradation underlies ?-synucleinopathy.
26496226 2015 Immediate-early response 5 (IER5) interacts with protein phosphatase 2A and regulates the phosphorylation of ribosomal protein S6 kinase and heat shock factor 1.
26473447 2015 The novel combination of dual mTOR inhibitor AZD2014 and pan-PIM inhibitor AZD1208 inhibits growth in acute myeloid leukemia via HSF pathway suppression.
26427350 2016 Ginsenoside Rg3 induces FUT4-mediated apoptosis in H. pylori CagA-treated gastric cancer cells by regulating SP1 and HSF1 expressions.
26361762 2016 Hsp70-1: upregulation via selective phosphorylation of heat shock factor 1 during coxsackieviral infection and promotion of viral replication via the AU-rich element.
26359349 2015 Heat shock factor 1, an inhibitor of non-homologous end joining repair.