Property Summary

NCBI Gene PubMed Count 138
Grant Count 11
R01 Count 7
Funding $2,642,880.2
PubMed Score 36.33
PubTator Score 128.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
acute quadriplegic myopathy 1.155 0.000
Breast cancer 2.200 0.037
ovarian cancer -1.500 0.000

Gene RIF (71)

PMID Text
26975582 Data indicate that clathrin-mediated endocytosis of proto-oncogene protein erbB-3 (ErbB3) is depending on epsin-1.
26136365 SMAP2 immunoprecipitated clathrin and AP-1 through a putative clathrin-binding domain and a CALM-binding domain, and SMAP2 mutants that did not interact with clathrin or AP-1 could not localize to recycling endosomes
25860340 The CHC:ESR1 interaction is required to sustain estradiol signaling.
25690657 Data suggest that by binding to both clathrin and F-actin, mammalian actin-binding protein 1 (mAbp1; HIP-55 or SH3P7) is specifically recruited at a late stage of clathrin-coated pits (CCPs) formation, which subsequently recruits dynamin to CCPs.
25631092 Our data support a model in which nascent Hepatits C Virus particles associate with apoE in the endoplasmic reticulum and exit cells following a clathrin-dependent transendosomal secretory route.
25455218 In conclusion these data suggest that Streptococcus pneumoniae PspC-promoted uptake via the polymeric immunoglobulin receptor of epithelial cells is mediated by both clathrin and caveolin dependent pathway.
25388970 autophagy contributed to Cx31.1 degradation, and clathrin might be involved in the autophagy of Cx31.1.
25180771 clathrin-mediated and caveolae-mediated endocytosis of VE-cad contribute to lipopolysaccharide-induced vascular hyperpermeability.
24407285 These data indicate that clathrin is required for the function of AP-1- and GGA-coated carriers at the trans-Golgi network but may be dispensable for outward traffic en route to the plasma membrane.
24211445 Clathrin and caveolin-1 have a role in docking of SMAD4 at the cell membrane.
More...

AA Sequence

MAQILPIRFQEHLQLQNLGINPANIGFSTLTMESDKFICIREKVGEQAQVVIIDMNDPSNPIRRPISADS      1 - 70
AIMNPASKVIALKAGKTLQIFNIEMKSKMKAHTMTDDVTFWKWISLNTVALVTDNAVYHWSMEGESQPVK     71 - 140
MFDRHSSLAGCQIINYRTDAKQKWLLLTGISAQQNRVVGAMQLYSVDRKVSQPIEGHAASFAQFKMEGNA    141 - 210
EESTLFCFAVRGQAGGKLHIIEVGTPPTGNQPFPKKAVDVFFPPEAQNDFPVAMQISEKHDVVFLITKYG    211 - 280
YIHLYDLETGTCIYMNRISGETIFVTAPHEATAGIIGVNRKGQVLSVCVEEENIIPYITNVLQNPDLALR    281 - 350
MAVRNNLAGAEELFARKFNALFAQGNYSEAAKVAANAPKGILRTPDTIRRFQSVPAQPGQTSPLLQYFGI    351 - 420
LLDQGQLNKYESLELCRPVLQQGRKQLLEKWLKEDKLECSEELGDLVKSVDPTLALSVYLRANVPNKVIQ    421 - 490
CFAETGQVQKIVLYAKKVGYTPDWIFLLRNVMRISPDQGQQFAQMLVQDEEPLADITQIVDVFMEYNLIQ    491 - 560
QCTAFLLDALKNNRPSEGPLQTRLLEMNLMHAPQVADAILGNQMFTHYDRAHIAQLCEKAGLLQRALEHF    561 - 630
TDLYDIKRAVVHTHLLNPEWLVNYFGSLSVEDSLECLRAMLSANIRQNLQICVQVASKYHEQLSTQSLIE    631 - 700
LFESFKSFEGLFYFLGSIVNFSQDPDVHFKYIQAACKTGQIKEVERICRESNCYDPERVKNFLKEAKLTD    701 - 770
QLPLIIVCDRFDFVHDLVLYLYRNNLQKYIEIYVQKVNPSRLPVVIGGLLDVDCSEDVIKNLILVVRGQF    771 - 840
STDELVAEVEKRNRLKLLLPWLEARIHEGCEEPATHNALAKIYIDSNNNPERFLRENPYYDSRVVGKYCE    841 - 910
KRDPHLACVAYERGQCDLELINVCNENSLFKSLSRYLVRRKDPELWGSVLLESNPYRRPLIDQVVQTALS    911 - 980
ETQDPEEVSVTVKAFMTADLPNELIELLEKIVLDNSVFSEHRNLQNLLILTAIKADRTRVMEYINRLDNY    981 - 1050
DAPDIANIAISNELFEEAFAIFRKFDVNTSAVQVLIEHIGNLDRAYEFAERCNEPAVWSQLAKAQLQKGM   1051 - 1120
VKEAIDSYIKADDPSSYMEVVQAANTSGNWEELVKYLQMARKKARESYVETELIFALAKTNRLAELEEFI   1121 - 1190
NGPNNAHIQQVGDRCYDEKMYDAAKLLYNNVSNFGRLASTLVHLGEYQAAVDGARKANSTRTWKEVCFAC   1191 - 1260
VDGKEFRLAQMCGLHIVVHADELEELINYYQDRGYFEELITMLEAALGLERAHMGMFTELAILYSKFKPQ   1261 - 1330
KMREHLELFWSRVNIPKVLRAAEQAHLWAELVFLYDKYEEYDNAIITMMNHPTDAWKEGQFKDIITKVAN   1331 - 1400
VELYYRAIQFYLEFKPLLLNDLLMVLSPRLDHTRAVNYFSKVKQLPLVKPYLRSVQNHNNKSVNESLNNL   1401 - 1470
FITEEDYQALRTSIDAYDNFDNISLAQRLEKHELIEFRRIAAYLFKGNNRWKQSVELCKKDSLYKDAMQY   1471 - 1540
ASESKDTELAEELLQWFLQEEKRECFGACLFTCYDLLRPDVVLETAWRHNIMDFAMPYFIQVMKEYLTKV   1541 - 1610
DKLDASESLRKEEEQATETQPIVYGQPQLMLTAGPSVAVPPQAPFGYGYTAPPYGQPQPGFGYSM        1611 - 1675
//

Text Mined References (158)

PMID Year Title
26975582 2016 Interaction with epsin 1 regulates the constitutive clathrin-dependent internalization of ErbB3.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26136365 2015 Transport of the cholera toxin B-subunit from recycling endosomes to the Golgi requires clathrin and AP-1.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25860340 2015 Clathrin Heavy Chain Interacts With Estrogen Receptor ? and Modulates 17?-Estradiol Signaling.
25690657 2015 Mammalian actin-binding protein 1/HIP-55 is essential for the scission of clathrin-coated pits by regulating dynamin-actin interaction.
25631092 2015 Clathrin mediates infectious hepatitis C virus particle egress.
25596274 2015 TACC3-ch-TOG track the growing tips of microtubules independently of clathrin and Aurora-A phosphorylation.
25455218 2014 Endocytosis of Streptococcus pneumoniae via the polymeric immunoglobulin receptor of epithelial cells relies on clathrin and caveolin dependent mechanisms.
25388970 2015 Connexin 31.1 degradation requires the Clathrin-mediated autophagy in NSCLC cell H1299.
More...