Property Summary

NCBI Gene PubMed Count 96
Grant Count 133
R01 Count 60
Funding $13,068,602.07
PubMed Score 629.38
PubTator Score 562.61

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
malignant mesothelioma 2.200 0.000
group 3 medulloblastoma 1.700 0.000
medulloblastoma, large-cell 1.300 0.005

Synonym

Accession Q00597 B1ALR8 Protein FACC
Symbols FA3
FAC
FACC

Gene

Gene RIF (45)

PMID Text
26842001 Lung adenocarcinomas in both male and female patients were associated with (a) genotypic polymorphisms of FANCC and FANCD1.
26778106 Israeli ATM, BLM, and FANCC heterozygous mutation carriers are not at an increased risk for developing cancer.
26466335 FANCC interacts and co-localizes with STMN1 at centrosomes during mitosis. We also showed that FANCC is required for STMN1 phosphorylation.
25545896 The successful in vitro repair of the mutated Fanconi anemia FANCC gene using the CRISPR/Cas9 system has been described.
24676280 FANCC interferes with UNC5A's functions in apoptosis and suggest that FANCC may participate in developmental processes through association with the dependence receptor UNC5A.
24046015 Data indicate that TLR-induced IL-1beta overproduction in FANCA- and FANCC-deficient mononuclear phagocyte cell lines and primary cells requires activation of the inflammasome.
23028338 we identified faults in two genes, Fanconi C and Bloom helicase( FANCC and BLM), in six families. Faults in these genes appear to increase the risk of developing breast cancer
21861228 deregulations of the FANCC-mediated DNA damage repair pathway and the PTCH1-associated sonic hedgehog pathway are associated with the development of early dysplastic head and neck lesions.
21697891 FA DNA repair genes, FANCD2, FANCL, and FANCC, are transcriptionally upregulated differently in melanoma compared with non-melanoma skin cancer
21670957 FANCC polymorphisms might be associated with the obstructive symptoms in allergic diseases.
More...

AA Sequence

MAQDSVDLSCDYQFWMQKLSVWDQASTLETQQDTCLHVAQFQEFLRKMYEALKEMDSNTVIERFPTIGQL      1 - 70
LAKACWNPFILAYDESQKILIWCLCCLINKEPQNSGQSKLNSWIQGVLSHILSALRFDKEVALFTQGLGY     71 - 140
APIDYYPGLLKNMVLSLASELRENHLNGFNTQRRMAPERVASLSRVCVPLITLTDVDPLVEALLICHGRE    141 - 210
PQEILQPEFFEAVNEAILLKKISLPMSAVVCLWLRHLPSLEKAMLHLFEKLISSERNCLRRIECFIKDSS    211 - 280
LPQAACHPAIFRVVDEMFRCALLETDGALEIIATIQVFTQCFVEALEKASKQLRFALKTYFPYTSPSLAM    281 - 350
VLLQDPQDIPRGHWLQTLKHISELLREAVEDQTHGSCGGPFESWFLFIHFGGWAEMVAEQLLMSAAEPPT    351 - 420
ALLWLLAFYYGPRDGRQQRAQTMVQVKAVLGHLLAMSRSSSLSAQDLQTVAGQGTDTDLRAPAQQLIRHL    421 - 490
LLNFLLWAPGGHTIAWDVITLMAHTAEITHEIIGFLDQTLYRWNRLGIESPRSEKLARELLKELRTQV      491 - 558
//

Text Mined References (95)

PMID Year Title
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
26842001 2016 Fanconi anemia genes in lung adenocarcinoma- a pathway-wide study on cancer susceptibility.
26778106 2016 The risk for developing cancer in Israeli ATM, BLM, and FANCC heterozygous mutation carriers.
26466335 2015 The Fanconi Anemia C Protein Binds to and Regulates Stathmin-1 Phosphorylation.
25545896 2015 Fanconi anemia gene editing by the CRISPR/Cas9 system.
24676280 2014 The Fanconi anemia group C protein interacts with uncoordinated 5A and delays apoptosis.
24046015 2013 FANCA and FANCC modulate TLR and p38 MAPK-dependent expression of IL-1? in macrophages.
23028338 2012 Exome sequencing identifies rare deleterious mutations in DNA repair genes FANCC and BLM as potential breast cancer susceptibility alleles.
22266823 2012 Regulation of Rev1 by the Fanconi anemia core complex.
22020285 2011 Image-based genome-wide siRNA screen identifies selective autophagy factors.
More...