Property Summary

NCBI Gene PubMed Count 21
PubMed Score 7.77
PubTator Score 7.06

Knowledge Summary


No data available


  Disease (2)

Disease Target Count P-value
glioblastoma 5792 1.1e-07
atypical teratoid / rhabdoid tumor 5112 1.5e-02
adult high grade glioma 3801 1.6e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5


  Differential Expression (3)

Disease log2 FC p
adult high grade glioma 1.300 1.6e-02
atypical teratoid / rhabdoid tumor 1.100 1.5e-02
glioblastoma 2.000 1.1e-07

Gene RIF (2)

AA Sequence

WESLDEEWRAPQAGSRTPVPSTVQANTFEFADAEEDDEVKV                                 351 - 391

Text Mined References (31)

PMID Year Title