Property Summary

NCBI Gene PubMed Count 20
Grant Count 4
Funding $171,276.25
PubMed Score 7.27
PubTator Score 7.06

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (3)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.100 0.015
glioblastoma 2.000 0.000
adult high grade glioma 1.300 0.016

Synonym

Accession Q00587 A8K825 Q96GN1
Symbols CEP1
BORG5
MSE55

Gene

Gene RIF (1)

PMID Text
15574879 CDC42EP1 activation is required for mannose receptor-mediated phagocytosis by alveolar macrophages.

AA Sequence

MPGPQGGRGAATMSLGKLSPVGWVSSSQGKRRLTADMISHPLGDFRHTMHVGRGGDVFGDTSFLSNHGGS      1 - 70
SGSTHRSPRSFLAKKLQLVRRVGAPPRRMASPPAPSPAPPAISPIIKNAISLPQLNQAAYDSLVVGKLSF     71 - 140
DSSPTSSTDGHSSYGLDSGFCTISRLPRSEKPHDRDRDGSFPSEPGLRRSDSLLSFRLDLDLGPSLLSEL    141 - 210
LGVMSLPEAPAAETPAPAANPPAPTANPTGPAANPPATTANPPAPAANPSAPAATPTGPAANPPAPAASS    211 - 280
TPHGHCPNGVTAGLGPVAEVKSSPVGGGPRGPAGPALGRHWGAGWDGGHHYPEMDARQERVEVLPQARAS    281 - 350
WESLDEEWRAPQAGSRTPVPSTVQANTFEFADAEEDDEVKV                                 351 - 391
//

Text Mined References (30)

PMID Year Title
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21988832 2011 Toward an understanding of the protein interaction network of the human liver.
21423176 2011 Analysis of the myosin-II-responsive focal adhesion proteome reveals a role for ?-Pix in negative regulation of focal adhesion maturation.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
20936779 2010 A human MAP kinase interactome.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
More...