Property Summary

NCBI Gene PubMed Count 60
PubMed Score 158.67
PubTator Score 118.16

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Expression

  Differential Expression (12)

Disease log2 FC p
adult high grade glioma -1.700 8.0e-05
atypical teratoid / rhabdoid tumor -1.500 3.3e-07
glioblastoma -1.200 4.5e-05
group 3 medulloblastoma -1.200 2.2e-04
hepatocellular carcinoma 1.300 3.1e-05
invasive ductal carcinoma -1.300 3.7e-04
lung cancer -1.700 3.4e-03
medulloblastoma, large-cell -2.100 3.0e-06
nephrosclerosis 1.011 8.7e-05
ovarian cancer -2.500 2.1e-08
primitive neuroectodermal tumor -1.500 4.7e-04
tuberculosis -1.100 7.8e-04

Gene RIF (40)

AA Sequence

MADRDSGSEQGGAALGSGGSLGHPGSGSGSGGGGGGGGGGGGSGGGGGGAPGGLQHETQELASKRVDIQN      1 - 70
KRFYLDVKQNAKGRFLKIAEVGAGGNKSRLTLSMSVAVEFRDYLGDFIEHYAQLGPSQPPDLAQAQDEPR     71 - 140
RALKSEFLVRENRKYYMDLKENQRGRFLRIRQTVNRGPGLGSTQGQTIALPAQGLIEFRDALAKLIDDYG    141 - 210
VEEEPAELPEGTSLTVDNKRFFFDVGSNKYGVFMRVSEVKPTYRNSITVPYKVWAKFGHTFCKYSEEMKK    211 - 280
IQEKQREKRAACEQLHQQQQQQQEETAAATLLLQGEEEGEED                                281 - 322
//

Text Mined References (65)

PMID Year Title