Property Summary

NCBI Gene PubMed Count 56
Grant Count 83
R01 Count 46
Funding $12,448,141.91
PubMed Score 153.56
PubTator Score 118.16

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
nephrosclerosis 1.011 0.000
hepatocellular carcinoma 1.300 0.000
glioblastoma -1.700 0.002
medulloblastoma -1.700 0.001
atypical teratoid / rhabdoid tumor -2.000 0.000
medulloblastoma, large-cell -3.100 0.000
primitive neuroectodermal tumor -1.600 0.009
tuberculosis and treatment for 6 months -1.600 0.000
lung cancer -1.700 0.003
adult high grade glioma -2.200 0.000
invasive ductal carcinoma -1.300 0.000
ovarian cancer -2.500 0.000

Synonym

Accession Q00577
Symbols PUR1
MRD31
PURALPHA
PUR-ALPHA

Gene

Gene RIF (44)

PMID Text
25439098 Mutations in PURA cause profound neonatal hypotonia, seizures, and encephalopathy in 5q31.3 microdeletion syndrome.
25342064 These findings provide definitive evidence for the role of PURA in causing a variable syndrome of neurodevelopmental delay, learning disability, neonatal hypotonia, feeding difficulties, abnormal movements and epilepsy in humans
24819879 Data show that protein PURalpha is specifically involved in the transcriptional activation of the secondary promoter and may exert its function by forming a complex with E2F-1 and RNA polymerase II.
24446247 Suggest dynamic interplay between transcriptional activators Pur-alpha/Pur-beta and repressors in regulating SMalphaA gene output during myofibroblast differentiation.
23152365 HIV-1 Tat proteins from different clades modulate differently Pur-alpha and SMAD4 to bind the JCV non-coding control region and affect differently on SMAD4 localization to the nucleus
22835829 This study showed that Pur-alpha showed inadequate expression in monocytes, and the translation of Pur-alpha mRNA was repressed by cell-expressed microRNA.
22337293 HIV-1 Tat proteins from different clades modulate differently Pur-alpha and SMAD4 to bind the JCV non-coding control region and affect differently on SMAD4 localization to the nucleus
21062477 The study identifies three functionally distinct PURA promoters and show that these are utilized differentially in human cell types and that they respond differently to cytomegalovirus infection.
19267365 Regulation of PURalpha expression in prostate cancer cells may serve as a therapeutic target for hormone refractory prostate cancer.
19182532 HIV-1 Tat proteins from different clades modulate differently Pur-alpha and SMAD4 to bind the JCV non-coding control region and affect differently on SMAD4 localization to the nucleus
More...

AA Sequence

MADRDSGSEQGGAALGSGGSLGHPGSGSGSGGGGGGGGGGGGSGGGGGGAPGGLQHETQELASKRVDIQN      1 - 70
KRFYLDVKQNAKGRFLKIAEVGAGGNKSRLTLSMSVAVEFRDYLGDFIEHYAQLGPSQPPDLAQAQDEPR     71 - 140
RALKSEFLVRENRKYYMDLKENQRGRFLRIRQTVNRGPGLGSTQGQTIALPAQGLIEFRDALAKLIDDYG    141 - 210
VEEEPAELPEGTSLTVDNKRFFFDVGSNKYGVFMRVSEVKPTYRNSITVPYKVWAKFGHTFCKYSEEMKK    211 - 280
IQEKQREKRAACEQLHQQQQQQQEETAAATLLLQGEEEGEED                                281 - 322
//

Text Mined References (62)

PMID Year Title
25439098 2014 Mutations in PURA cause profound neonatal hypotonia, seizures, and encephalopathy in 5q31.3 microdeletion syndrome.
25342064 2014 Whole exome sequencing in family trios reveals de novo mutations in PURA as a cause of severe neurodevelopmental delay and learning disability.
24819879 2014 Identification of a secondary promoter of CASP8 and its related transcription factor PUR?.
24446247 2014 The Pur?/Pur? single-strand DNA-binding proteins attenuate smooth-muscle actin gene transactivation in myofibroblasts.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22835829 2012 Translation of Pur-? is targeted by cellular miRNAs to modulate the differentiation-dependent susceptibility of monocytes to HIV-1 infection.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
More...