Property Summary

Ligand Count 4
NCBI Gene PubMed Count 15
PubMed Score 3.10
PubTator Score 1.10

Knowledge Summary

Patent (1,632)

Expression

  Differential Expression (13)

Disease log2 FC p
acute quadriplegic myopathy 1.075 1.5e-07
atypical teratoid / rhabdoid tumor -1.600 5.2e-05
dermatomyositis 1.200 1.9e-03
diabetes mellitus -1.200 1.1e-02
Gaucher disease type 3 -1.100 5.8e-03
glioblastoma -1.100 2.9e-02
group 4 medulloblastoma 2.100 9.2e-03
juvenile dermatomyositis 1.116 2.2e-10
malignant mesothelioma -1.200 3.7e-04
medulloblastoma, large-cell 1.500 1.3e-04
osteosarcoma 1.587 4.4e-04
ovarian cancer -1.200 3.0e-03
tuberculosis -1.400 9.5e-07

Gene RIF (1)

AA Sequence

MKKFKRRLSLTLRGSQTIDESLSELAEQMTIEENSSKDNEPIVKNGRPPTSHSMHSFLHQYTGSFKKPPL      1 - 70
RRPHSVIGGSLGSFMAMPRNGSRLDIVHENLKMGSDGESDQASGTSSDEVQSPTGVCLRNRIHRRISMED     71 - 140
LNKRLSLPADIRIPDGYLEKLQINSPPFDQPMSRRSRRASLSEIGFGKMETYIKLEKLGEGTYATVYKGR    141 - 210
SKLTENLVALKEIRLEHEEGAPCTAIREVSLLKDLKHANIVTLHDIVHTDKSLTLVFEYLDKDLKQYMDD    211 - 280
CGNIMSMHNVKLFLYQILRGLAYCHRRKVLHRDLKPQNLLINEKGELKLADFGLARAKSVPTKTYSNEVV    281 - 350
TLWYRPPDVLLGSSEYSTQIDMWGVGCIFFEMASGRPLFPGSTVEDELHLIFRLLGTPSQETWPGISSNE    351 - 420
EFKNYNFPKYKPQPLINHAPRLDSEGIELITKFLQYESKKRVSAEEAMKHVYFRSLGPRIHALPESVSIF    421 - 490
SLKEIQLQKDPGFRNSSYPETGHGKNRRQSMLF                                         491 - 523
//

Text Mined References (24)

PMID Year Title