Property Summary

NCBI Gene PubMed Count 14
PubMed Score 3.08
PubTator Score 1.10

Knowledge Summary

Patent (1,632)

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
juvenile dermatomyositis 1189 2.15226912145263E-10
acute quadriplegic myopathy 1157 1.54833731090997E-7
tuberculosis 1563 9.47048162226853E-7
atypical teratoid / rhabdoid tumor 4369 5.1989782589514E-5
medulloblastoma, large-cell 6234 1.70783882723052E-4
malignant mesothelioma 3163 3.66244863569944E-4
osteosarcoma 7933 4.3877551145585E-4
dermatomyositis 967 0.00193964812560125
ovarian cancer 8492 0.00304869831759398
Gaucher disease type 3 76 0.00584738560701462
group 4 medulloblastoma 1875 0.0092266107784963
diabetes mellitus 1663 0.0108231468785124
glioblastoma 5572 0.0287303366153951
Disease Target Count Z-score Confidence
Acquired metabolic disease 267 0.0 1.0

Expression

  Differential Expression (13)

Disease log2 FC p
malignant mesothelioma -1.200 0.000
osteosarcoma 1.587 0.000
glioblastoma -1.100 0.029
atypical teratoid / rhabdoid tumor -1.600 0.000
group 4 medulloblastoma 2.100 0.009
medulloblastoma, large-cell -1.700 0.000
juvenile dermatomyositis 1.116 0.000
acute quadriplegic myopathy 1.075 0.000
tuberculosis -1.400 0.000
diabetes mellitus -1.200 0.011
ovarian cancer -1.200 0.003
Gaucher disease type 3 -1.100 0.006
dermatomyositis 1.200 0.002

Synonym

Accession Q00537 A8K1U6 B2RCQ2 Q8NEB8
Symbols PCTK2
PCTAIRE2

Gene

  Ortholog (11)

  TechDev Info (1)

Gary Johnson Kinome profile via MIB/MS Technology

 Collection (1)

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

AA Sequence

MKKFKRRLSLTLRGSQTIDESLSELAEQMTIEENSSKDNEPIVKNGRPPTSHSMHSFLHQYTGSFKKPPL      1 - 70
RRPHSVIGGSLGSFMAMPRNGSRLDIVHENLKMGSDGESDQASGTSSDEVQSPTGVCLRNRIHRRISMED     71 - 140
LNKRLSLPADIRIPDGYLEKLQINSPPFDQPMSRRSRRASLSEIGFGKMETYIKLEKLGEGTYATVYKGR    141 - 210
SKLTENLVALKEIRLEHEEGAPCTAIREVSLLKDLKHANIVTLHDIVHTDKSLTLVFEYLDKDLKQYMDD    211 - 280
CGNIMSMHNVKLFLYQILRGLAYCHRRKVLHRDLKPQNLLINEKGELKLADFGLARAKSVPTKTYSNEVV    281 - 350
TLWYRPPDVLLGSSEYSTQIDMWGVGCIFFEMASGRPLFPGSTVEDELHLIFRLLGTPSQETWPGISSNE    351 - 420
EFKNYNFPKYKPQPLINHAPRLDSEGIELITKFLQYESKKRVSAEEAMKHVYFRSLGPRIHALPESVSIF    421 - 490
SLKEIQLQKDPGFRNSSYPETGHGKNRRQSMLF                                         491 - 523
//

Text Mined References (23)

PMID Year Title
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22359512 2012 Genome-wide association study identifies novel loci associated with circulating phospho- and sphingolipid concentrations.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21248752 2011 Exome sequencing identifies frequent mutation of the SWI/SNF complex gene PBRM1 in renal carcinoma.
19884882 2009 Cyclin-dependent kinases: a family portrait.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19369195 2009 Large-scale proteomics analysis of the human kinome.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
More...