Property Summary

NCBI Gene PubMed Count 38
Grant Count 6
R01 Count 6
Funding $356,112.75
PubMed Score 32.26
PubTator Score 21.29

Knowledge Summary

Patent (4,108)

Expression

  Differential Expression (9)

Disease log2 FC p
Rheumatoid Arthritis -1.100 0.020
psoriasis -1.900 0.000
posterior fossa group B ependymoma -1.700 0.000
medulloblastoma, large-cell -1.400 0.000
adult high grade glioma -1.200 0.000
pilocytic astrocytoma -1.100 0.000
subependymal giant cell astrocytoma -1.108 0.028
Breast cancer 1.100 0.000
acute myeloid leukemia 1.200 0.002

Synonym

Accession Q00536 A8K280 B7Z7C8 J3KN74 J3KQP7
Symbols PCTK1
PCTAIRE
PCTAIRE1
PCTGAIRE

Gene

PDB

3MTL  

  TechDev Info (1)

Gary Johnson Kinome profile via MIB/MS Technology

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (14)

PMID Text
26546806 CDK-16 upregulation in serous EOC cells may represent a negative feedback loop to promote ovarian cell differentiation in malignantly-transformed serous epithelial ovarian cancer cells
26205494 Activation of PCTAIRE-1 is mediated through interaction with the phosphorylated form of cyclin Y in complex with 14-3-3.
25809707 GALNT7 and CDK16 were confirmed to be the direct targets of miR-494. These results suggested that miR-494 play an inhibitory role in the tumorigenesis of NPC
25605337 PCTK1 regulates spindle orientation through phosphorylation of Ser83 on KAP0, a regulatory subunit of protein kinase A.
25402633 PCTK1 in the proliferation and survival of medulloblastoma characterized by cMYC amplification
25205104 An unexpected role for PCTAIRE1 in regulating p27 stability, mitosis, and tumor growth.
24931367 Pctaire1 exerts promyogenic effects by regulating myoblast migration and process formation during skeletal myogenesis
23692340 Dysfunction of MKL2 and its transcriptional coactivation partner, serum response factor (SRF), was supported by a decrease in gene and protein expression of PCTAIRE1, a downstream target of MKL2:SRF heterodimer transcriptional activation
22798068 a novel function of BRSK2 in the regulation of GSIS in beta-cells via a PCTAIRE1-dependent mechanism and suggest that BRSK2 is an attractive target for developing novel diabetic drugs.
22184064 CCNY binding to CDK16 required a region upstream of the kinase domain and was found to be inhibited by phosphorylation of serine 153, a potential PKA phosphorylation site.
More...

AA Sequence

MDRMKKIKRQLSMTLRGGRGIDKTNGAPEQIGLDESGGGGGSDPGEAPTRAAPGELRSARGPLSSAPEIV      1 - 70
HEDLKMGSDGESDQASATSSDEVQSPVRVRMRNHPPRKISTEDINKRLSLPADIRLPEGYLEKLTLNSPI     71 - 140
FDKPLSRRLRRVSLSEIGFGKLETYIKLDKLGEGTYATVYKGKSKLTDNLVALKEIRLEHEEGAPCTAIR    141 - 210
EVSLLKDLKHANIVTLHDIIHTEKSLTLVFEYLDKDLKQYLDDCGNIINMHNVKLFLFQLLRGLAYCHRQ    211 - 280
KVLHRDLKPQNLLINERGELKLADFGLARAKSIPTKTYSNEVVTLWYRPPDILLGSTDYSTQIDMWGVGC    281 - 350
IFYEMATGRPLFPGSTVEEQLHFIFRILGTPTEETWPGILSNEEFKTYNYPKYRAEALLSHAPRLDSDGA    351 - 420
DLLTKLLQFEGRNRISAEDAMKHPFFLSLGERIHKLPDTTSIFALKEIQLQKEASLRSSSMPDSGRPAFR    421 - 490
VVDTEF                                                                    491 - 496
//

Text Mined References (45)

PMID Year Title
26546806 2015 Upregulated CDK16 Expression in Serous Epithelial Ovarian Cancer Cells.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26205494 2015 Cyclin Y phosphorylation- and 14-3-3-binding-dependent activation of PCTAIRE-1/CDK16.
25852190 2015 Integrative analysis of kinase networks in TRAIL-induced apoptosis provides a source of potential targets for combination therapy.
25809707 2015 Functional elucidation of miR-494 in the tumorigenesis of nasopharyngeal carcinoma.
25605337 2015 PCTK1 regulates integrin-dependent spindle orientation via protein kinase A regulatory subunit KAP0 and myosin X.
25416956 2014 A proteome-scale map of the human interactome network.
25402633 2015 RNA interference screening identifies a novel role for PCTK1/CDK16 in medulloblastoma with c-Myc amplification.
25205104 2014 PCTAIRE1 phosphorylates p27 and regulates mitosis in cancer cells.
24931367 2014 Pctaire1/Cdk16 promotes skeletal myogenesis by inducing myoblast migration and fusion.
More...