Property Summary

Ligand Count 9
NCBI Gene PubMed Count 39
PubMed Score 34.22
PubTator Score 21.29

Knowledge Summary

Patent (4,108)

Expression

  Differential Expression (9)

Disease log2 FC p
acute myeloid leukemia 1.200 2.5e-03
adult high grade glioma -1.200 1.6e-04
Astrocytoma, Pilocytic -1.100 9.0e-08
Breast cancer 1.100 1.4e-09
ependymoma -1.500 6.3e-14
medulloblastoma, large-cell -1.400 3.9e-05
psoriasis -1.900 1.9e-05
Rheumatoid arthritis -1.100 2.0e-02
subependymal giant cell astrocytoma -1.108 2.8e-02

Gene RIF (15)

AA Sequence

MDRMKKIKRQLSMTLRGGRGIDKTNGAPEQIGLDESGGGGGSDPGEAPTRAAPGELRSARGPLSSAPEIV      1 - 70
HEDLKMGSDGESDQASATSSDEVQSPVRVRMRNHPPRKISTEDINKRLSLPADIRLPEGYLEKLTLNSPI     71 - 140
FDKPLSRRLRRVSLSEIGFGKLETYIKLDKLGEGTYATVYKGKSKLTDNLVALKEIRLEHEEGAPCTAIR    141 - 210
EVSLLKDLKHANIVTLHDIIHTEKSLTLVFEYLDKDLKQYLDDCGNIINMHNVKLFLFQLLRGLAYCHRQ    211 - 280
KVLHRDLKPQNLLINERGELKLADFGLARAKSIPTKTYSNEVVTLWYRPPDILLGSTDYSTQIDMWGVGC    281 - 350
IFYEMATGRPLFPGSTVEEQLHFIFRILGTPTEETWPGILSNEEFKTYNYPKYRAEALLSHAPRLDSDGA    351 - 420
DLLTKLLQFEGRNRISAEDAMKHPFFLSLGERIHKLPDTTSIFALKEIQLQKEASLRSSSMPDSGRPAFR    421 - 490
VVDTEF                                                                    491 - 496
//

Text Mined References (46)

PMID Year Title