Property Summary

NCBI Gene PubMed Count 262
PubMed Score 1238.43
PubTator Score 542.82

Knowledge Summary

Patent (42,088)

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Lissencephaly 7 with cerebellar hypoplasia 1 0.0 0.0
Tauopathies 3 0.0 0.0
Disease Target Count Z-score Confidence
Neurodegenerative disease 402 0.0 4.0

Expression

  Differential Expression (17)

Disease log2 FC p
adult high grade glioma -1.500 6.6e-05
astrocytic glioma -1.400 2.3e-03
Astrocytoma, Pilocytic -1.700 2.9e-08
atypical teratoid / rhabdoid tumor -1.600 3.3e-09
Breast cancer 1.500 9.4e-21
colon cancer 1.200 4.4e-02
ependymoma -1.700 8.0e-03
glioblastoma -1.300 1.8e-04
invasive ductal carcinoma 1.400 3.5e-03
lung cancer 1.800 6.6e-05
lung carcinoma 1.100 4.3e-20
malignant mesothelioma -1.300 6.1e-06
medulloblastoma -1.300 1.3e-04
medulloblastoma, large-cell -1.300 5.9e-04
oligodendroglioma -1.200 1.6e-02
Pick disease -1.100 1.0e-02
tuberculosis 1.500 1.5e-07

Protein-protein Interaction (8)

Gene RIF (170)

AA Sequence

MQKYEKLEKIGEGTYGTVFKAKNRETHEIVALKRVRLDDDDEGVPSSALREICLLKELKHKNIVRLHDVL      1 - 70
HSDKKLTLVFEFCDQDLKKYFDSCNGDLDPEIVKSFLFQLLKGLGFCHSRNVLHRDLKPQNLLINRNGEL     71 - 140
KLADFGLARAFGIPVRCYSAEVVTLWYRPPDVLFGAKLYSTSIDMWSAGCIFAELANAGRPLFPGNDVDD    141 - 210
QLKRIFRLLGTPTEEQWPSMTKLPDYKPYPMYPATTSLVNVVPKLNATGRDLLQNLLKCNPVQRISAEEA    211 - 280
LQHPYFSDFCPP                                                              281 - 292
//

Text Mined References (288)

PMID Year Title