Property Summary

NCBI Gene PubMed Count 245
Grant Count 577
R01 Count 336
Funding $60,187,157.66
PubMed Score 1184.79
PubTator Score 542.82

Knowledge Summary

Patent (42,088)

Expression

  Differential Expression (17)

Disease log2 FC p
malignant mesothelioma -1.300 0.000
astrocytoma -1.500 0.020
ependymoma -1.700 0.008
oligodendroglioma -1.200 0.016
atypical teratoid / rhabdoid tumor -1.600 0.000
glioblastoma -1.300 0.000
medulloblastoma -1.300 0.000
medulloblastoma, large-cell -1.300 0.001
tuberculosis 1.500 0.000
colon cancer 1.200 0.044
lung cancer 1.800 0.000
adult high grade glioma -1.500 0.000
pilocytic astrocytoma -1.700 0.000
lung carcinoma 1.100 0.000
Pick disease -1.100 0.010
Breast cancer 1.500 0.000
invasive ductal carcinoma 1.400 0.003

Synonym

Accession Q00535 A1XKG3
Symbols LIS7
PSSALRE

Gene

PDB

1H4L   1LFR   1UNG   1UNH   1UNL   3O0G   4AU8  

  TechDev Info (1)

Gary Johnson Kinome profile via MIB/MS Technology

MLP Assay (3)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448
504938 other 3 / 0 / 0 Late stage assay provider counterscreen results from the probe development effort to identify non-agonists of the peroxisome proliferator-activated receptor gamma (PPARg): chemiluminescence-based biochemical western blot assay for inhibitors of phosphorylation of PPARG protein levels
588725 other 0 / 0 / 1 Late stage counterscreen results from the probe development effort to identify inhibitors of kruppel-like factor 5 (KLF5): Radioactivity-based biochemical assay to identify modulators of a panel of 48 kinases

Gene RIF (156)

PMID Text
26966064 These results for the first time demonstrate a role of Cdk5/p35 in the regulation of cell cycle progression modulated by TGF-beta1.
26930193 Data show that cyclin-dependent kinase 5 (Cdk5) could phosphorylate the adjacent S1627 in the leucine-rich repeat kinase 2 (LRRK2) R1628P mutant.
26860827 High cyclin-dependent kinase 5 expression is associated with non-small cell lung cancer and small cell lung cancer.
26698249 A cyclin I-Cdk5 complex forms a critical antiapoptotic factor in the process of generating cisplatin resistance in cervical cancer.
26690371 A novel role of STAT3/miR-21 axis and CDK5/CDK5R1 (p35) in metastasis of head and neck squamous cell carcinoma.
26558783 Nuclear Cdk5 is involved in the regulation of activity-dependent gene transcription and dendritic growth.
26555036 These data identify a novel oncogenic mechanism where CDK5 activation induces CRMP2A phosphorylation in the nuclei of tumour cells
26469698 These p35 mutations are unlikely to cause mental retardation.
26339373 Increased expression of CDK5 infers poor outcomes for nasopharyngeal carcinoma patients.
26317805 Results reveal a link between p25 and BACE1 in Alzheimer disease (AD) brains and suggest that upregulated Cdk5 activation by p25 accelerates AD pathogenesis by enhancing BACE1 activity via phosphorylation.
More...

AA Sequence

MQKYEKLEKIGEGTYGTVFKAKNRETHEIVALKRVRLDDDDEGVPSSALREICLLKELKHKNIVRLHDVL      1 - 70
HSDKKLTLVFEFCDQDLKKYFDSCNGDLDPEIVKSFLFQLLKGLGFCHSRNVLHRDLKPQNLLINRNGEL     71 - 140
KLADFGLARAFGIPVRCYSAEVVTLWYRPPDVLFGAKLYSTSIDMWSAGCIFAELANAGRPLFPGNDVDD    141 - 210
QLKRIFRLLGTPTEEQWPSMTKLPDYKPYPMYPATTSLVNVVPKLNATGRDLLQNLLKCNPVQRISAEEA    211 - 280
LQHPYFSDFCPP                                                              281 - 292
//

Text Mined References (271)

PMID Year Title
27107012 2016 Pooled-matrix protein interaction screens using Barcode Fusion Genetics.
26966064 2016 Transforming growth factor-?1 induces cell cycle arrest by activating atypical cyclin-dependent kinase 5 through up-regulation of Smad3-dependent p35 expression in human MCF10A mammary epithelial cells.
26930193 2016 Parkinson-Related LRRK2 Mutation R1628P Enables Cdk5 Phosphorylation of LRRK2 and Upregulates Its Kinase Activity.
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
26860827 2016 An immunohistochemical study of cyclin-dependent kinase 5 (CDK5) expression in non-small cell lung cancer (NSCLC) and small cell lung cancer (SCLC): a possible prognostic biomarker.
26698249 2015 Cyclin I promotes cisplatin resistance via Cdk5 activation in cervical cancer.
26690371 2015 Targeting STAT3/miR-21 axis inhibits epithelial-mesenchymal transition via regulating CDK5 in head and neck squamous cell carcinoma.
26558783 2015 Cdk5 Regulates Activity-Dependent Gene Expression and Dendrite Development.
26555036 2015 Phosphorylation of a splice variant of collapsin response mediator protein 2 in the nucleus of tumour cells links cyclin dependent kinase-5 to oncogenesis.
26469698 2015 Effects of p35 Mutations Associated with Mental Retardation on the Cellular Function of p35-CDK5.
More...