Property Summary

NCBI Gene PubMed Count 222
Grant Count 226
R01 Count 125
Funding $13,466,299.85
PubMed Score 362.18
PubTator Score 374.93

Knowledge Summary

Patent (29,832)

Expression

  Differential Expression (27)

Synonym

Accession Q00534 A4D1G0
Symbols MCPH12
PLSTIRE

Gene

PDB

1BI7   1G3N   1BI8   1BLX   1JOW   1XO2   2EUF   2F2C   3NUP   3NUX   4AUA   4EZ5   4TTH   5L2I   5L2T  

  TechDev Info (2)

Gary Johnson Kinome profile via MIB/MS Technology
Michael McManus Genetic interaction screen

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
652206 other 0 / 0 / 0 ML-187 activity in a kinase panel for Extended probe characterization for beta-cell apoptosis Measured in Biochemical System

Gene RIF (151)

PMID Text
26857361 This review highlights our current understanding of CDK signaling in both normal and malignant breast tissues, with special attention placed on recent clinical advances in inhibition of CDK4/6 in ER+ disease
26822763 Results show that NEAT1 regulated CDK6 expression in laryngeal squamous cell cancer (LSCC) cells which was mediated by miR-107; NEAT1 plays an oncogenic role in the tumorigenesis of LSCC.
26644182 PHD1 is phosphorylated by CDK2, CDK4 and CDK6 at Serine 130.
26542173 A ZFP36L1-mediated regulatory circuit through repressing CDK6 expression.
26503549 three uniquely identified proteins (CDK6 , galectin-3-binding protein and LDH C) were found, which show tight connection with prostate cancer and presence of all of them was previously linked to certain aspects of prostate cancer
26498144 Data indicate that microRNA miR-214 has tumor-suppressive activity in hepatocellular carcinoma (HCC) through inhibition of E2F2 transcription factor (E2F2), cyclin-dependent kinases CDK3 and CDK6.
26494299 MiR-26a and mir-584 inhibit the binding of hnRNP A1-CDK6 mRNA and induce colorectal cancer cell apoptosis.
26369631 The concept that cotargeting MEK and CDK4/6 would prove efficacious in KRAS-mutant (KRAS(mt)) colorectal cancers.
26352175 Downregulation of microRNA33a promotes the expression CDK6, CCND1, and PIM1, and gastric cancer cell proliferation.
26278580 These data enhance our understanding of the important role that GAS5 plays in the molecular etiology of GC and suggest a potential of GAS5 as a new therapeutic target for GC treatment.
More...

AA Sequence

MEKDGLCRADQQYECVAEIGEGAYGKVFKARDLKNGGRFVALKRVRVQTGEEGMPLSTIREVAVLRHLET      1 - 70
FEHPNVVRLFDVCTVSRTDRETKLTLVFEHVDQDLTTYLDKVPEPGVPTETIKDMMFQLLRGLDFLHSHR     71 - 140
VVHRDLKPQNILVTSSGQIKLADFGLARIYSFQMALTSVVVTLWYRAPEVLLQSSYATPVDLWSVGCIFA    141 - 210
EMFRRKPLFRGSSDVDQLGKILDVIGLPGEEDWPRDVALPRQAFHSKSAQPIEKFVTDIDELGKDLLLKC    211 - 280
LTFNPAKRISAYSALSHPYFQDLERCKENLDSHLPPSQNTSELNTA                            281 - 326
//

Text Mined References (236)

PMID Year Title
27107012 2016 Pooled-matrix protein interaction screens using Barcode Fusion Genetics.
26857361 2016 Targeting the cyclin-dependent kinases (CDK) 4/6 in estrogen receptor-positive breast cancers.
26822763 2016 Long noncoding RNA NEAT1 promotes laryngeal squamous cell cancer through regulating miR-107/CDK6 pathway.
26644182 2016 CDK-dependent phosphorylation of PHD1 on serine 130 alters its substrate preference in cells.
26542173 2015 ZFP36L1 promotes monocyte/macrophage differentiation by repressing CDK6.
26503549 2015 Differences in urinary proteins related to surgical margin status after radical prostatectomy.
26498144 2016 miR-214/199a/199a* cluster levels predict poor survival in hepatocellular carcinoma through interference with cell-cycle regulators.
26494299 2015 microRNA-26a and -584 inhibit the colorectal cancer progression through inhibition of the binding of hnRNP A1-CDK6 mRNA.
26369631 2016 Sensitivity of KRAS-Mutant Colorectal Cancers to Combination Therapy That Cotargets MEK and CDK4/6.
26352175 2015 Downregulation of microRNA?33a promotes cyclin?dependent kinase 6, cyclin D1 and PIM1 expression and gastric cancer cell proliferation.
More...