Property Summary

NCBI Gene PubMed Count 14
Grant Count 207
R01 Count 163
Funding $12,047,603.68
PubMed Score 5.41
PubTator Score 34.99

Knowledge Summary

Patent (20,339)

Expression

  Differential Expression (12)

Disease log2 FC p
astrocytic glioma -1.400 0.005
oligodendroglioma -1.100 0.013
psoriasis -3.000 0.000
osteosarcoma -2.280 0.000
cystic fibrosis -1.277 0.000
atypical teratoid / rhabdoid tumor -1.700 0.000
glioblastoma -1.300 0.004
medulloblastoma -1.500 0.000
primitive neuroectodermal tumor -1.600 0.001
colon cancer -1.900 0.002
lung cancer -2.200 0.000
interstitial cystitis -1.300 0.001

Synonym

Accession Q00532 Q2M3A4 Q6QUA0 Q8WXQ5
Symbols P42
KKIALRE

Gene

PDB

4AGU  

 Collection (1)

Gene RIF (3)

PMID Text
22804458 CDKL1 was overexpressed in breast cancer patients and had a positive detection efficiency of 77% (144/186).
22369697 High expression of CDKL1 protein was associated with gastric cancer.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MEKYEKIGKIGEGSYGVVFKCRNRDTGQIVAIKKFLESEDDPVIKKIALREIRMLKQLKHPNLVNLLEVF      1 - 70
RRKRRLHLVFEYCDHTVLHELDRYQRGVPEHLVKSITWQTLQAVNFCHKHNCIHRDVKPENILITKHSVI     71 - 140
KLCDFGFARLLAGPSDYYTDYVATRWYRSPELLVGDTQYGPPVDVWAIGCVFAELLSGVPLWPGKSDVDQ    141 - 210
LYLIRKTLGDLIPRHQQVFSTNQYFSGVKIPDPEDMEPLELKFPNISYPALGLLKGCLHMDPTQRLTCEQ    211 - 280
LLHHPYFENIREIEDLAKEHNKPTRKTLRKSRKHHCFTETSKLQYLPQLTGSSILPALDNKKYYCDTKKL    281 - 350
NYRFPNI                                                                   351 - 357
//

Text Mined References (17)

PMID Year Title
24347629 2014 Genome-wide association study of periodontal health measured by probing depth in adults ages 18-49 years.
22804458 2012 Evaluation of cyclin-dependent kinase-like 1 expression in breast cancer tissues and its regulation in cancer cell growth.
22369697 2012 A role for Cdkl1 in the development of gastric cancer.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20125193 2010 Common genetic variation and performance on standardized cognitive tests.
18570454 2008 Proteomic analysis of exosomes from human neural stem cells by flow field-flow fractionation and nanoflow liquid chromatography-tandem mass spectrometry.
17344846 2007 Patterns of somatic mutation in human cancer genomes.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15761153 2005 High-throughput mapping of a dynamic signaling network in mammalian cells.
15499549 2004 Mutations in the X-linked cyclin-dependent kinase-like 5 (CDKL5/STK9) gene are associated with severe neurodevelopmental retardation.
More...