Property Summary

NCBI Gene PubMed Count 27
Grant Count 14
R01 Count 11
Funding $738,465.15
PubMed Score 22.41
PubTator Score 22.87

Knowledge Summary

Patent (15,474)

Expression

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (6)

PMID Text
26498144 Data indicate that microRNA miR-214 has tumor-suppressive activity in hepatocellular carcinoma (HCC) through inhibition of E2F2 transcription factor (E2F2), cyclin-dependent kinases CDK3 and CDK6.
25531331 Mir-873 inhibits ESR1 activity and cell growth via targeting CDK3.
24691537 CDK3 is associated with the progression of NPC, and may be a potential biomarker for prediction of the prognosis of patients with NPC.
21067790 The Walleye dermal sarcoma virus cyclin functions as a structural ortholog of cyclin C in spite of its limited amino acid sequence identity with C cyclins or with any known cyclins and activates Cdk8 and Cdk3.
18794154 Expression level of cdk3 is higher in human cancer cell lines and glioblastoma tissue compared with normal brain tissue. cdk3 phosphorylates activating transcription factor 1 (ATF1)and enhances the transactivation and transcriptional activities of ATF1.
15084261 A non-cdk8-associated cellular pool of cyclin C combines with cdk3 to stimulate pRb phosphorylation at S807/811 during the G0/G1 transition, and this phosphorylation is required for cells to exit G0 efficiently.

AA Sequence

MDMFQKVEKIGEGTYGVVYKAKNRETGQLVALKKIRLDLEMEGVPSTAIREISLLKELKHPNIVRLLDVV      1 - 70
HNERKLYLVFEFLSQDLKKYMDSTPGSELPLHLIKSYLFQLLQGVSFCHSHRVIHRDLKPQNLLINELGA     71 - 140
IKLADFGLARAFGVPLRTYTHEVVTLWYRAPEILLGSKFYTTAVDIWSIGCIFAEMVTRKALFPGDSEID    141 - 210
QLFRIFRMLGTPSEDTWPGVTQLPDYKGSFPKWTRKGLEEIVPNLEPEGRDLLMQLLQYDPSQRITAKTA    211 - 280
LAHPYFSSPEPSPAARQYVLQRFRH                                                 281 - 305
//

Text Mined References (28)

PMID Year Title
26498144 2016 miR-214/199a/199a* cluster levels predict poor survival in hepatocellular carcinoma through interference with cell-cycle regulators.
25531331 2015 MiR-873 regulates ER? transcriptional activity and tamoxifen resistance via targeting CDK3 in breast cancer cells.
24691537 2014 CDK3 expression and its clinical significance in human nasopharyngeal carcinoma.
24550317 2014 PARP1-dependent recruitment of KDM4D histone demethylase to DNA damage sites promotes double-strand break repair.
23602568 2013 The protein interaction landscape of the human CMGC kinase group.
21067790 2011 The retroviral cyclin of walleye dermal sarcoma virus binds cyclin-dependent kinases 3 and 8.
18794154 2008 Cyclin-dependent kinase 3-mediated activating transcription factor 1 phosphorylation enhances cell transformation.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17344846 2007 Patterns of somatic mutation in human cancer genomes.
17192257 2007 Proteomics analysis of protein kinases by target class-selective prefractionation and tandem mass spectrometry.
More...