Property Summary

Ligand Count 2
NCBI Gene PubMed Count 32
PubMed Score 25.27
PubTator Score 22.87

Knowledge Summary

Patent (15,474)

Expression

 MGI Phenotype (1)

Gene RIF (9)

AA Sequence

MDMFQKVEKIGEGTYGVVYKAKNRETGQLVALKKIRLDLEMEGVPSTAIREISLLKELKHPNIVRLLDVV      1 - 70
HNERKLYLVFEFLSQDLKKYMDSTPGSELPLHLIKSYLFQLLQGVSFCHSHRVIHRDLKPQNLLINELGA     71 - 140
IKLADFGLARAFGVPLRTYTHEVVTLWYRAPEILLGSKFYTTAVDIWSIGCIFAEMVTRKALFPGDSEID    141 - 210
QLFRIFRMLGTPSEDTWPGVTQLPDYKGSFPKWTRKGLEEIVPNLEPEGRDLLMQLLQYDPSQRITAKTA    211 - 280
LAHPYFSSPEPSPAARQYVLQRFRH                                                 281 - 305
//

Text Mined References (33)

PMID Year Title