Property Summary

NCBI Gene PubMed Count 106
PubMed Score 410.06
PubTator Score 221.35

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (7)

Disease log2 FC p
dermatomyositis 1.300 1.9e-04
diabetes mellitus -1.100 1.4e-03
intraductal papillary-mucinous neoplasm ... 1.300 2.9e-02
lung cancer -1.100 2.1e-04
Multiple myeloma 1.637 1.3e-03
osteosarcoma -1.080 2.6e-03
ovarian cancer -1.300 6.6e-06

Protein-protein Interaction (13)

Gene RIF (43)

AA Sequence

MASTSRLDALPRVTCPNHPDAILVEDYRAGDMICPECGLVVGDRVIDVGSEWRTFSNDKATKDPSRVGDS      1 - 70
QNPLLSDGDLSTMIGKGTGAASFDEFGNSKYQNRRTMSSSDRAMMNAFKEITTMADRINLPRNIVDRTNN     71 - 140
LFKQVYEQKSLKGRANDAIASACLYIACRQEGVPRTFKEICAVSRISKKEIGRCFKLILKALETSVDLIT    141 - 210
TGDFMSRFCSNLCLPKQVQMAATHIARKAVELDLVPGRSPISVAAAAIYMASQASAEKRTQKEIGDIAGV    211 - 280
ADVTIRQSYRLIYPRAPDLFPTDFKFDTPVDKLPQL                                      281 - 316
//

Text Mined References (115)

PMID Year Title