Property Summary

NCBI Gene PubMed Count 106
Grant Count 204
R01 Count 171
Funding $16,285,033.28
PubMed Score 396.13
PubTator Score 221.35

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
Multiple myeloma 1.637 0.001
osteosarcoma -1.080 0.003
intraductal papillary-mucinous neoplasm ... 1.300 0.029
lung cancer -1.100 0.000
diabetes mellitus -1.100 0.001
ovarian cancer -1.300 0.000
dermatomyositis 1.300 0.000

Synonym

Accession Q00403 A8K1A7 Q5JS30
Symbols TF2B
TFIIB

Gene

PANTHER Protein Class (1)

PDB

5IY6   5IY7   5IY8   5IY9   5IYA   5IYB   5IYC   5IYD   1C9B   1DL6   1RLY   1RO4   1TFB   1VOL   2PHG  

 GWAS Trait (1)

Gene RIF (45)

PMID Text
26284261 binding of specific DNA sequences changes the protein structure and dynamics, and TFIIB may exist in two conformational states
26016528 The role of zinc at Cys3His1 binding site in the absence of TFIIB protein folding
25492609 Association of the winged helix motif of the TFIIEalpha subunit of TFIIE with either the TFIIEbeta subunit or TFIIB distinguishes its functions in transcription.
24441171 these results establish a new paradigm for TFIIB functionality in human gene expression, which when downregulated has potent anti-viral effects.
23827503 Binding of HIV-1 Tat to p300 induces a conformational change in the CBP/p300 complex such that it can acquire and bind better to transcription factors such as TBP and TFIIB, indicating Tat helps CBP/p300 recruit new partners to the transcription machinery
23827503 Binding of HIV-1 Tat to p300 induces a conformational change in the CBP/p300 complex such that it can acquire and bind better to transcription factors such as TBP and TFIIB, indicating Tat helps CBP/p300 recruit new partners to the transcription machinery
23115335 a mode of phospho-TFIIB-independent transcriptional regulation that prioritizes the transcription of p53-target genes during cellular stress.
23055019 TFIIB was involved in the proliferation and growth of HCC cells.
21896726 Data show that TFIIF has an important role in stabilizing TFIIB within the PIC and after transcription initiates.
21489275 Binding of HIV-1 Tat to p300 induces a conformational change in the CBP/p300 complex such that it can acquire and bind better to transcription factors such as TBP and TFIIB, indicating Tat helps CBP/p300 recruit new partners to the transcription machinery
More...

AA Sequence

MASTSRLDALPRVTCPNHPDAILVEDYRAGDMICPECGLVVGDRVIDVGSEWRTFSNDKATKDPSRVGDS      1 - 70
QNPLLSDGDLSTMIGKGTGAASFDEFGNSKYQNRRTMSSSDRAMMNAFKEITTMADRINLPRNIVDRTNN     71 - 140
LFKQVYEQKSLKGRANDAIASACLYIACRQEGVPRTFKEICAVSRISKKEIGRCFKLILKALETSVDLIT    141 - 210
TGDFMSRFCSNLCLPKQVQMAATHIARKAVELDLVPGRSPISVAAAAIYMASQASAEKRTQKEIGDIAGV    211 - 280
ADVTIRQSYRLIYPRAPDLFPTDFKFDTPVDKLPQL                                      281 - 316
//

Text Mined References (115)

PMID Year Title
27193682 2016 Near-atomic resolution visualization of human transcription promoter opening.
26284261 2015 In vitro fluorescence studies of transcription factor IIB-DNA interaction.
26016528 2015 Evaluation of the Intrinsic Zn(II) Affinity of a Cys3His1 Site in the Absence of Protein Folding Effects.
25492609 2015 Association of the winged helix motif of the TFIIE? subunit of TFIIE with either the TFIIE? subunit or TFIIB distinguishes its functions in transcription.
25416956 2014 A proteome-scale map of the human interactome network.
24441171 2014 A new paradigm for transcription factor TFIIB functionality.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23115335 2012 TFIIB dephosphorylation links transcription inhibition with the p53-dependent DNA damage response.
23055019 2013 General transcription factor IIb overexpression and a potential link to proliferation in human hepatocellular carcinoma.
More...