Property Summary

NCBI Gene PubMed Count 43
Grant Count 60
R01 Count 44
Funding $9,252,664.95
PubMed Score 103.18
PubTator Score 76.59

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
ependymoma 1.200 0.013
oligodendroglioma 1.100 0.007
psoriasis 1.800 0.000
astrocytoma 1.300 0.004
medulloblastoma, large-cell 1.200 0.000
adrenocortical carcinoma -1.031 0.001
intraductal papillary-mucinous neoplasm ... -1.800 0.004
lung cancer 1.300 0.000
subependymal giant cell astrocytoma -2.003 0.004
invasive ductal carcinoma -1.113 0.004
ovarian cancer 2.500 0.000

Synonym

Accession Q00341 B4DTQ2 E7EM71 Q53QU2 Q9UCY3
Symbols HBP
VGL
PRO2900

Gene

PDB

1VIG   1VIH   2CTE   2CTF   2CTJ   2CTK   2CTL   2CTM  

Gene RIF (13)

PMID Text
25631074 Cellular biotinylated high density lipoprotein binding protein (HDLBP, Vigilin) is incorporated into HIV-1 Gag virus-like particles
24676454 progressively upregulated vigilin may serve as a molecular risk marker for hepatocellular carcinoma development, and targeting vigilin may help to inhibit hepatocellular carcinoma cell growth, survival and migration.
24561205 CTCF may regulate vigilin behavior and thus indirectly influence the binding of HP1alpha to the satellite 2 locus
21500547 Vigilin may have a relationship with hepatocellular carcinoma progression and proliferation.
20974809 identified a competition for binding the 69-nt sequence, through which vigilin and HuR exert opposing effects on c-fms expression, suggesting a role for vigilin in suppression of breast cancer progression
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20442750 Observational study of gene-disease association. (HuGE Navigator)
19950580 Expression profiles of human VIGILIN, H19, and IGF2 mRNA increased with cell-cycle prograssion.
19913121 Observational study of gene-disease association. (HuGE Navigator)
19878569 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MSSVAVLTQESFAEHRSGLVPQQIKVATLNSEEESDPPTYKDAFPPLPEKAACLESAQEPSGAWGNKIRP      1 - 70
IKASVITQVFHVPLEERKYKDMNQFGEGEQAKICLEIMQRTGAHLELSLAKDQGLSIMVSGKLDAVMKAR     71 - 140
KDIVARLQTQASATVAIPKEHHRFVIGKNGEKLQDLELKTATKIQIPRPDDPSNQIKITGTKEGIEKARH    141 - 210
EVLLISAEQDKRAVERLEVEKAFHPFIAGPYNRLVGEIMQETGTRINIPPPSVNRTEIVFTGEKEQLAQA    211 - 280
VARIKKIYEEKKKKTTTIAVEVKKSQHKYVIGPKGNSLQEILERTGVSVEIPPSDSISETVILRGEPEKL    281 - 350
GQALTEVYAKANSFTVSSVAAPSWLHRFIIGKKGQNLAKITQQMPKVHIEFTEGEDKITLEGPTEDVNVA    351 - 420
QEQIEGMVKDLINRMDYVEINIDHKFHRHLIGKSGANINRIKDQYKVSVRIPPDSEKSNLIRIEGDPQGV    421 - 490
QQAKRELLELASRMENERTKDLIIEQRFHRTIIGQKGERIREIRDKFPEVIINFPDPAQKSDIVQLRGPK    491 - 560
NEVEKCTKYMQKMVADLVENSYSISVPIFKQFHKNIIGKGGANIKKIREESNTKIDLPAENSNSETIIIT    561 - 630
GKRANCEAARSRILSIQKDLANIAEVEVSIPAKLHNSLIGTKGRLIRSIMEECGGVHIHFPVEGSGSDTV    631 - 700
VIRGPSSDVEKAKKQLLHLAEEKQTKSFTVDIRAKPEYHKFLIGKGGGKIRKVRDSTGARVIFPAAEDKD    701 - 770
QDLITIIGKEDAVREAQKELEALIQNLDNVVEDSMLVDPKHHRHFVIRRGQVLREIAEEYGGVMVSFPRS    771 - 840
GTQSDKVTLKGAKDCVEAAKKRIQEIIEDLEAQVTLECAIPQKFHRSVMGPKGSRIQQITRDFSVQIKFP    841 - 910
DREENAVHSTEPVVQENGDEAGEGREAKDCDPGSPRRCDIIIISGRKEKCEAAKEALEALVPVTIEVEVP    911 - 980
FDLHRYVIGQKGSGIRKMMDEFEVNIHVPAPELQSDIIAITGLAANLDRAKAGLLERVKELQAEQEDRAL    981 - 1050
RSFKLSVTVDPKYHPKIIGRKGAVITQIRLEHDVNIQFPDKDDGNQPQDQITITGYEKNTEAARDAILRI   1051 - 1120
VGELEQMVSEDVPLDHRVHARIIGARGKAIRKIMDEFKVDIRFPQSGAPDPNCVTVTGLPENVEEAIDHI   1121 - 1190
LNLEEEYLADVVDSEALQVYMKPPAHEEAKAPSRGFVVRDAPWTASSSEKAPDMSSSEEFPSFGAQVAPK   1191 - 1260
TLPWGPKR                                                                 1261 - 1268
//

Text Mined References (56)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
24725430 2014 Vigilin interacts with CCCTC-binding factor (CTCF) and is involved in CTCF-dependent regulation of the imprinted genes Igf2 and H19.
24676454 2014 Vigilin is overexpressed in hepatocellular carcinoma and is required for HCC cell proliferation and tumor growth.
24561205 2014 CTCF-mediated reduction of vigilin binding affects the binding of HP1? to the satellite 2 locus.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23535732 2013 Identification of 23 new prostate cancer susceptibility loci using the iCOGS custom genotyping array.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
More...