Property Summary

NCBI Gene PubMed Count 23
PubMed Score 635.12
PubTator Score 50.74

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (4)

Disease Target Count
IGA Glomerulonephritis 454
Disease Target Count P-value
atypical teratoid / rhabdoid tumor 4369 3.44310753351286E-10
ependymoma 2514 3.84151723528321E-8
pilocytic astrocytoma 3086 1.14164410496511E-5
ovarian cancer 8492 1.90776908918255E-5
glioblastoma 5572 2.13384145192885E-4
medulloblastoma, large-cell 6234 3.46543422729126E-4
adult high grade glioma 2148 3.73160861708739E-4
lung cancer 4473 0.00173328626502336
pancreatic ductal adenocarcinoma liver metastasis 1795 0.0371566854411632
Disease Target Count Z-score Confidence
Mucoepidermoid carcinoma 19 4.56 2.3
Pontocerebellar hypoplasia 29 3.886 1.9

Expression

  Differential Expression (9)

Disease log2 FC p
ependymoma -1.100 0.000
glioblastoma -1.500 0.000
atypical teratoid / rhabdoid tumor -1.500 0.000
medulloblastoma, large-cell -1.300 0.000
pancreatic ductal adenocarcinoma liver m... -1.581 0.037
lung cancer 1.100 0.002
adult high grade glioma -1.300 0.000
pilocytic astrocytoma -1.100 0.000
ovarian cancer -2.100 0.000

Synonym

Accession Q00325 B3KS34 Q7Z7N7 Q96A03
Symbols PHC
PTP
OK/SW-cl.48

Gene

  Ortholog (13)

Species Source
Chimp OMA EggNOG
Macaque OMA Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
S.cerevisiae OMA Inparanoid

Gene RIF (5)

PMID Text
23266187 Compares and contrasts all the known human SLC25A* genes and includes functional information.
20877624 Observational study of gene-disease association. (HuGE Navigator)
19405953 This protein has been found differentially expressed in the Wernicke's Area from patients with schizophrenia.
17273968 SLC25A3 protein deficiency is associated with lactic acidosis, hypertrophic cardiomyopathy, and muscular hypotonia
15984930 An analysis of the promoter region of the human mitochondrial phosphate transporter, including its activation and inhibition domains, is reported.

AA Sequence

MFSSVAHLARANPFNTPHLQLVHDGLGDLRSSSPGPTGQPRRPRNLAAAAVEEQYSCDYGSGRFFILCGL      1 - 70
GGIISCGTTHTALVPLDLVKCRMQVDPQKYKGIFNGFSVTLKEDGVRGLAKGWAPTFLGYSMQGLCKFGF     71 - 140
YEVFKVLYSNMLGEENTYLWRTSLYLAASASAEFFADIALAPMEAAKVRIQTQPGYANTLRDAAPKMYKE    141 - 210
EGLKAFYKGVAPLWMRQIPYTMMKFACFERTVEALYKFVVPKPRSECSKPEQLVVTFVAGYIAGVFCAIV    211 - 280
SHPADSVVSVLNKEKGSSASLVLKRLGFKGVWKGLFARIIMIGTLTALQWFIYDSVKVYFRLPRPPPPEM    281 - 350
PESLKKKLGLTQ                                                              351 - 362
//

Text Mined References (29)

PMID Year Title
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23266187 The mitochondrial transporter family SLC25: identification, properties and physiopathology.
23209302 2012 KIF14 negatively regulates Rap1a-Radil signaling during breast cancer progression.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
19946888 2010 Defining the membrane proteome of NK cells.
More...