Property Summary

NCBI Gene PubMed Count 24
PubMed Score 703.39
PubTator Score 50.74

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
adult high grade glioma -1.300 3.7e-04
atypical teratoid / rhabdoid tumor -1.500 3.4e-10
ependymoma -1.100 3.8e-08
glioblastoma -1.100 1.2e-05
lung cancer 1.100 1.7e-03
medulloblastoma, large-cell -1.300 3.5e-04
ovarian cancer -2.100 1.9e-05
pancreatic ductal adenocarcinoma liver m... -1.581 3.7e-02
Pilocytic astrocytoma -1.100 1.1e-05

Gene RIF (6)

AA Sequence

MFSSVAHLARANPFNTPHLQLVHDGLGDLRSSSPGPTGQPRRPRNLAAAAVEEQYSCDYGSGRFFILCGL      1 - 70
GGIISCGTTHTALVPLDLVKCRMQVDPQKYKGIFNGFSVTLKEDGVRGLAKGWAPTFLGYSMQGLCKFGF     71 - 140
YEVFKVLYSNMLGEENTYLWRTSLYLAASASAEFFADIALAPMEAAKVRIQTQPGYANTLRDAAPKMYKE    141 - 210
EGLKAFYKGVAPLWMRQIPYTMMKFACFERTVEALYKFVVPKPRSECSKPEQLVVTFVAGYIAGVFCAIV    211 - 280
SHPADSVVSVLNKEKGSSASLVLKRLGFKGVWKGLFARIIMIGTLTALQWFIYDSVKVYFRLPRPPPPEM    281 - 350
PESLKKKLGLTQ                                                              351 - 362
//

Text Mined References (30)

PMID Year Title