Property Summary

NCBI Gene PubMed Count 23
Grant Count 24
R01 Count 13
Funding $2,689,878.75
PubMed Score 635.12
PubTator Score 50.74

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
ependymoma -1.100 0.000
glioblastoma -1.500 0.000
atypical teratoid / rhabdoid tumor -1.500 0.000
medulloblastoma, large-cell -1.300 0.000
pancreatic ductal adenocarcinoma liver m... -1.581 0.037
lung cancer 1.100 0.002
adult high grade glioma -1.300 0.000
pilocytic astrocytoma -1.100 0.000
ovarian cancer -2.100 0.000

Gene RIF (5)

PMID Text
23266187 Compares and contrasts all the known human SLC25A* genes and includes functional information.
20877624 Observational study of gene-disease association. (HuGE Navigator)
19405953 This protein has been found differentially expressed in the Wernicke's Area from patients with schizophrenia.
17273968 SLC25A3 protein deficiency is associated with lactic acidosis, hypertrophic cardiomyopathy, and muscular hypotonia
15984930 An analysis of the promoter region of the human mitochondrial phosphate transporter, including its activation and inhibition domains, is reported.

AA Sequence

MFSSVAHLARANPFNTPHLQLVHDGLGDLRSSSPGPTGQPRRPRNLAAAAVEEQYSCDYGSGRFFILCGL      1 - 70
GGIISCGTTHTALVPLDLVKCRMQVDPQKYKGIFNGFSVTLKEDGVRGLAKGWAPTFLGYSMQGLCKFGF     71 - 140
YEVFKVLYSNMLGEENTYLWRTSLYLAASASAEFFADIALAPMEAAKVRIQTQPGYANTLRDAAPKMYKE    141 - 210
EGLKAFYKGVAPLWMRQIPYTMMKFACFERTVEALYKFVVPKPRSECSKPEQLVVTFVAGYIAGVFCAIV    211 - 280
SHPADSVVSVLNKEKGSSASLVLKRLGFKGVWKGLFARIIMIGTLTALQWFIYDSVKVYFRLPRPPPPEM    281 - 350
PESLKKKLGLTQ                                                              351 - 362
//

Publication (29)

PMID Year Title
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23266187 The mitochondrial transporter family SLC25: identification, properties and physiopathology.
23209302 2012 KIF14 negatively regulates Rap1a-Radil signaling during breast cancer progression.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
19946888 2010 Defining the membrane proteome of NK cells.
More...